Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | hok-sok/- |
| Location | 3706813..3707071 | Replicon | chromosome |
| Accession | NZ_CP117650 | ||
| Organism | Escherichia albertii strain BIA_16-1 | ||
Toxin (Protein)
| Gene name | hokC | Uniprot ID | S1NX00 |
| Locus tag | PS055_RS17940 | Protein ID | WP_000809168.1 |
| Coordinates | 3706813..3706965 (-) | Length | 51 a.a. |
Antitoxin (RNA)
| Gene name | sokC | ||
| Locus tag | - | ||
| Coordinates | 3707014..3707071 (+) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PS055_RS17925 | 3702224..3704140 | + | 1917 | WP_059222122.1 | molecular chaperone DnaK | - |
| PS055_RS17930 | 3704229..3705359 | + | 1131 | WP_001118445.1 | molecular chaperone DnaJ | - |
| PS055_RS17935 | 3705622..3706735 | - | 1114 | Protein_3490 | IS4-like element IS421 family transposase | - |
| PS055_RS17940 | 3706813..3706965 | - | 153 | WP_000809168.1 | type I toxin-antitoxin system toxin MokC | Toxin |
| - | 3707014..3707071 | + | 58 | - | - | Antitoxin |
| PS055_RS17945 | 3707587..3708348 | + | 762 | WP_059220827.1 | outer membrane protein OmpK | - |
| PS055_RS17950 | 3708369..3709856 | + | 1488 | WP_059220825.1 | sulfatase-like hydrolase/transferase | - |
| PS055_RS17955 | 3710016..3711263 | + | 1248 | WP_059220823.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Genomic island | - | espX1 | 3705622..3715201 | 9579 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 51 a.a. Molecular weight: 5501.57 Da Isoelectric Point: 7.1312
>T271882 WP_000809168.1 NZ_CP117650:c3706965-3706813 [Escherichia albertii]
MKQHKAMIVALIVICITAVVAALVTRKDLCEVHIRTGQTEVAVFTAYESE
MKQHKAMIVALIVICITAVVAALVTRKDLCEVHIRTGQTEVAVFTAYESE
Download Length: 153 bp
Antitoxin
Download Length: 58 bp
>AT271882 NZ_CP117650:3707014-3707071 [Escherichia albertii]
GTTCTGCATATAGGGGGCCTCGGGTTGATGGTAAAATATCACTCGGGGCTTTTCTCTA
GTTCTGCATATAGGGGGCCTCGGGTTGATGGTAAAATATCACTCGGGGCTTTTCTCTA
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|