Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | hok-sok/- |
| Location | 1912967..1913211 | Replicon | chromosome |
| Accession | NZ_CP117650 | ||
| Organism | Escherichia albertii strain BIA_16-1 | ||
Toxin (Protein)
| Gene name | hokX | Uniprot ID | S1PD89 |
| Locus tag | PS055_RS09460 | Protein ID | WP_000956458.1 |
| Coordinates | 1912967..1913119 (-) | Length | 51 a.a. |
Antitoxin (RNA)
| Gene name | sokX | ||
| Locus tag | - | ||
| Coordinates | 1913164..1913211 (+) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PS055_RS09450 | 1908752..1911409 | - | 2658 | WP_059221338.1 | CRISPR-associated helicase/endonuclease Cas3 | - |
| PS055_RS09455 | 1911662..1912774 | + | 1113 | WP_095574181.1 | IS4-like element IS421 family transposase | - |
| PS055_RS09460 | 1912967..1913119 | - | 153 | WP_000956458.1 | Hok/Gef family protein | Toxin |
| - | 1913164..1913211 | + | 48 | - | - | Antitoxin |
| PS055_RS09465 | 1913383..1914117 | - | 735 | WP_001125132.1 | phosphoadenosine phosphosulfate reductase | - |
| PS055_RS09470 | 1914196..1915908 | - | 1713 | WP_059221001.1 | assimilatory sulfite reductase (NADPH) hemoprotein subunit | - |
| PS055_RS09475 | 1915908..1917707 | - | 1800 | WP_059221004.1 | NADPH-dependent assimilatory sulfite reductase flavoprotein subunit | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 51 a.a. Molecular weight: 5558.77 Da Isoelectric Point: 7.6757
>T271877 WP_000956458.1 NZ_CP117650:c1913119-1912967 [Escherichia albertii]
MLTKYALVAIIVLCCTVLGFTLMVGDSLCELSIRERGMEFKAVLAYESKK
MLTKYALVAIIVLCCTVLGFTLMVGDSLCELSIRERGMEFKAVLAYESKK
Download Length: 153 bp
Antitoxin
Download Length: 48 bp
>AT271877 NZ_CP117650:1913164-1913211 [Escherichia albertii]
GTTCGAACGTAGGCCTCAGGTTGATAGAAATATCGCCTGGGGCTTTTG
GTTCGAACGTAGGCCTCAGGTTGATAGAAATATCGCCTGGGGCTTTTG
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|