Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | hok-sok/- |
| Location | 72158..72581 | Replicon | plasmid pEA22_1 |
| Accession | NZ_CP117629 | ||
| Organism | Escherichia albertii strain BIA_22 | ||
Toxin (Protein)
| Gene name | hok | Uniprot ID | - |
| Locus tag | PS041_RS24745 | Protein ID | WP_223200913.1 |
| Coordinates | 72158..72280 (-) | Length | 41 a.a. |
Antitoxin (RNA)
| Gene name | srnC | ||
| Locus tag | - | ||
| Coordinates | 72365..72581 (-) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PS041_RS24715 (67890) | 67890..68003 | + | 114 | Protein_65 | secretion protein EspO | - |
| PS041_RS24720 (68205) | 68205..69045 | + | 841 | Protein_66 | IS481 family transposase | - |
| PS041_RS24725 (69133) | 69133..69296 | - | 164 | Protein_67 | IS3 family transposase | - |
| PS041_RS24730 (69326) | 69326..70897 | - | 1572 | WP_273817994.1 | IS66 family transposase | - |
| PS041_RS24735 (70917) | 70917..71264 | - | 348 | WP_000624622.1 | IS66 family insertion sequence element accessory protein TnpB | - |
| PS041_RS24740 (71264) | 71264..71911 | - | 648 | WP_273817995.1 | IS66-like element accessory protein TnpA | - |
| PS041_RS24745 (72158) | 72158..72280 | - | 123 | WP_223200913.1 | Hok/Gef family protein | Toxin |
| PS041_RS24750 (72225) | 72225..72377 | - | 153 | Protein_72 | DUF5431 family protein | - |
| - (72365) | 72365..72581 | - | 217 | NuclAT_0 | - | Antitoxin |
| - (72365) | 72365..72581 | - | 217 | NuclAT_0 | - | Antitoxin |
| - (72365) | 72365..72581 | - | 217 | NuclAT_0 | - | Antitoxin |
| - (72365) | 72365..72581 | - | 217 | NuclAT_0 | - | Antitoxin |
| PS041_RS24755 (72550) | 72550..73312 | - | 763 | Protein_73 | plasmid SOS inhibition protein A | - |
| PS041_RS24760 (73309) | 73309..73707 | - | 399 | WP_273825572.1 | conjugation system SOS inhibitor PsiB | - |
| PS041_RS24765 (74039) | 74039..74299 | + | 261 | Protein_75 | hypothetical protein | - |
| PS041_RS24770 (74498) | 74498..74689 | - | 192 | WP_001027500.1 | hypothetical protein | - |
| PS041_RS24775 (74686) | 74686..75107 | - | 422 | Protein_77 | hypothetical protein | - |
| PS041_RS24780 (75154) | 75154..75579 | - | 426 | WP_273825570.1 | antirestriction protein | - |
| PS041_RS24785 (75810) | 75810..76567 | - | 758 | Protein_79 | substrate-binding domain-containing protein | - |
| PS041_RS24790 (76978) | 76978..77278 | + | 301 | Protein_80 | transposase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Conjugative plasmid | sitABCD | vat / vat / nleA/espI / espK / iutA / iucD / iucC / iucB / iucA | 1..152064 | 152064 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 41 a.a. Molecular weight: 4538.38 Da Isoelectric Point: 8.2691
>T271776 WP_223200913.1 NZ_CP117629:c72280-72158 [Escherichia albertii]
IVCCTLLIFTLLTRNRLCEVRLKDGYREVTATMAYESGGK
IVCCTLLIFTLLTRNRLCEVRLKDGYREVTATMAYESGGK
Download Length: 123 bp
Antitoxin
Download Length: 217 bp
>AT271776 NZ_CP117629:c72581-72365 [Escherichia albertii]
TCACACGGATTTCCCGTGAACGGTCTGAATGAGCGGATTATTTTCAGGGAAAGTGAGTGTGGTCAGCGTGCAGGTATATG
GGCTATGATGTGCCCGGCGCTTGAGGCTTTCTGCCTCATGACGTGAAGGTGGTTTGTTATCCTGTCGTGCGGCAGAAGGA
CAAAAGCCCCGTAGTTAATTTTCATTAACCCACGAGGCCTCTGCATGTCTAGTCCAC
TCACACGGATTTCCCGTGAACGGTCTGAATGAGCGGATTATTTTCAGGGAAAGTGAGTGTGGTCAGCGTGCAGGTATATG
GGCTATGATGTGCCCGGCGCTTGAGGCTTTCTGCCTCATGACGTGAAGGTGGTTTGTTATCCTGTCGTGCGGCAGAAGGA
CAAAAGCCCCGTAGTTAATTTTCATTAACCCACGAGGCCTCTGCATGTCTAGTCCAC
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
