Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | ataRT/DUF1778(antitoxin) |
Location | 4349363..4350163 | Replicon | chromosome |
Accession | NZ_CP117628 | ||
Organism | Escherichia albertii strain BIA_22 |
Toxin (Protein)
Gene name | ataT | Uniprot ID | - |
Locus tag | PS041_RS21775 | Protein ID | WP_059228514.1 |
Coordinates | 4349363..4349890 (-) | Length | 176 a.a. |
Antitoxin (Protein)
Gene name | ataR | Uniprot ID | B1EHP0 |
Locus tag | PS041_RS21780 | Protein ID | WP_001277106.1 |
Coordinates | 4349897..4350163 (-) | Length | 89 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PS041_RS21750 (4344438) | 4344438..4345205 | - | 768 | WP_000082094.1 | high-affinity branched-chain amino acid ABC transporter ATP-binding protein LivG | - |
PS041_RS21755 (4345202) | 4345202..4346479 | - | 1278 | WP_059225128.1 | branched chain amino acid ABC transporter permease LivM | - |
PS041_RS21760 (4346476) | 4346476..4347402 | - | 927 | WP_001295111.1 | high-affinity branched-chain amino acid ABC transporter permease LivH | - |
PS041_RS21765 (4347450) | 4347450..4348559 | - | 1110 | WP_059256853.1 | high-affinity branched-chain amino acid ABC transporter substrate-binding protein LivK | - |
PS041_RS21770 (4348983) | 4348983..4349366 | + | 384 | WP_000778774.1 | aspartate 1-decarboxylase autocleavage activator PanM | - |
PS041_RS21775 (4349363) | 4349363..4349890 | - | 528 | WP_059228514.1 | type II toxin-antitoxin system toxin acetyltransferase AtaT | Toxin |
PS041_RS21780 (4349897) | 4349897..4350163 | - | 267 | WP_001277106.1 | type II toxin-antitoxin system antitoxin AtaR | Antitoxin |
PS041_RS21785 (4350313) | 4350313..4351416 | - | 1104 | WP_273824548.1 | branched chain amino acid ABC transporter substrate-binding protein LivJ | - |
PS041_RS21790 (4351938) | 4351938..4352339 | + | 402 | WP_001071334.1 | PTS sugar transporter subunit IIA | - |
PS041_RS21795 (4352346) | 4352346..4352831 | + | 486 | WP_000029259.1 | PTS sugar transporter subunit IIB | - |
PS041_RS21800 (4352848) | 4352848..4353594 | + | 747 | WP_000151888.1 | PTS sugar transporter subunit IIC | - |
PS041_RS21805 (4353587) | 4353587..4354441 | + | 855 | WP_000370584.1 | PTS system mannose/fructose/sorbose family transporter subunit IID | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 176 a.a. Molecular weight: 19623.53 Da Isoelectric Point: 6.6303
>T271773 WP_059228514.1 NZ_CP117628:c4349890-4349363 [Escherichia albertii]
MDDLTIEILTDDADYDLQRFDCGEEALNLFLTTHLVRQHRNKILRAYILCRNTPECQVLGYYTLSGSCFERAALPSKSKQ
KKIPYKNIPSVTLGRLAIDRSLQGQGWGATLVAHAMKVVWSASLAVGIHGLFVEALNEKAHTFYQSLGFIPLVGENENAL
FFPTKSIELLFTQSD
MDDLTIEILTDDADYDLQRFDCGEEALNLFLTTHLVRQHRNKILRAYILCRNTPECQVLGYYTLSGSCFERAALPSKSKQ
KKIPYKNIPSVTLGRLAIDRSLQGQGWGATLVAHAMKVVWSASLAVGIHGLFVEALNEKAHTFYQSLGFIPLVGENENAL
FFPTKSIELLFTQSD
Download Length: 528 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|