Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | phd-doc/Doc-RelB |
| Location | 2215807..2216411 | Replicon | chromosome |
| Accession | NZ_CP117628 | ||
| Organism | Escherichia albertii strain BIA_22 | ||
Toxin (Protein)
| Gene name | doc | Uniprot ID | B1EM00 |
| Locus tag | PS041_RS11085 | Protein ID | WP_000638401.1 |
| Coordinates | 2215807..2216193 (-) | Length | 129 a.a. |
Antitoxin (Protein)
| Gene name | phd | Uniprot ID | B1ELZ9 |
| Locus tag | PS041_RS11090 | Protein ID | WP_001195490.1 |
| Coordinates | 2216190..2216411 (-) | Length | 74 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PS041_RS11070 (2212175) | 2212175..2214814 | + | 2640 | WP_273825412.1 | autotransporter-associated beta strand repeat-containing protein | - |
| PS041_RS11075 (2214807) | 2214807..2215163 | + | 357 | WP_273825414.1 | autotransporter outer membrane beta-barrel domain-containing protein | - |
| PS041_RS11080 (2215200) | 2215200..2215727 | + | 528 | WP_273825416.1 | autotransporter outer membrane beta-barrel domain-containing protein | - |
| PS041_RS11085 (2215807) | 2215807..2216193 | - | 387 | WP_000638401.1 | type II toxin-antitoxin system death-on-curing family toxin | Toxin |
| PS041_RS11090 (2216190) | 2216190..2216411 | - | 222 | WP_001195490.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | Antitoxin |
| PS041_RS11095 (2216753) | 2216753..2217560 | + | 808 | Protein_2159 | helix-turn-helix domain-containing protein | - |
| PS041_RS11100 (2217775) | 2217775..2219127 | + | 1353 | WP_273825417.1 | SIR2 family protein | - |
| PS041_RS11105 (2219449) | 2219449..2220207 | + | 759 | WP_054410601.1 | trans-aconitate 2-methyltransferase | - |
| PS041_RS11110 (2220211) | 2220211..2221125 | - | 915 | WP_024164792.1 | bestrophin family protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Genomic island | - | - | 2206952..2236401 | 29449 | |
| - | flank | IS/Tn | - | - | 2217174..2217560 | 386 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 129 a.a. Molecular weight: 14505.49 Da Isoelectric Point: 8.0833
>T271767 WP_000638401.1 NZ_CP117628:c2216193-2215807 [Escherichia albertii]
MIWVSAQEVIAFHDRILQRFPGVAGLTDPGRAQALIYRVQNRVHYEGVTDLFELAATYWVAIARGHIFHDGNKRTAFFVT
MTFLWRNGIRIRDVDNSLENLTVEAATGEKTVGQLARCLRERVDSSGN
MIWVSAQEVIAFHDRILQRFPGVAGLTDPGRAQALIYRVQNRVHYEGVTDLFELAATYWVAIARGHIFHDGNKRTAFFVT
MTFLWRNGIRIRDVDNSLENLTVEAATGEKTVGQLARCLRERVDSSGN
Download Length: 387 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A3T5VDW2 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A2S6PD20 |