Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | symE-timR/SymE(toxin) |
| Location | 531167..531579 | Replicon | chromosome |
| Accession | NZ_CP117628 | ||
| Organism | Escherichia albertii strain BIA_22 | ||
Toxin (Protein)
| Gene name | symE | Uniprot ID | - |
| Locus tag | PS041_RS02685 | Protein ID | WP_044708303.1 |
| Coordinates | 531167..531508 (-) | Length | 114 a.a. |
Antitoxin (RNA)
| Gene name | timR | ||
| Locus tag | - | ||
| Coordinates | 531503..531579 (+) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PS041_RS02665 (527541) | 527541..528473 | + | 933 | WP_273824875.1 | Rpn family recombination-promoting nuclease/putative transposase | - |
| PS041_RS02670 (528626) | 528626..528799 | - | 174 | Protein_516 | GntR family transcriptional regulator | - |
| PS041_RS02675 (529024) | 529024..529900 | + | 877 | Protein_517 | DUF262 domain-containing protein | - |
| PS041_RS02680 (529954) | 529954..531120 | + | 1167 | WP_273824877.1 | DUF1524 domain-containing protein | - |
| PS041_RS02685 (531167) | 531167..531508 | - | 342 | WP_044708303.1 | endoribonuclease SymE | Toxin |
| - (531503) | 531503..531579 | + | 77 | NuclAT_10 | - | Antitoxin |
| - (531503) | 531503..531579 | + | 77 | NuclAT_10 | - | Antitoxin |
| - (531503) | 531503..531579 | + | 77 | NuclAT_10 | - | Antitoxin |
| - (531503) | 531503..531579 | + | 77 | NuclAT_10 | - | Antitoxin |
| - (531503) | 531503..531579 | + | 77 | NuclAT_11 | - | Antitoxin |
| - (531503) | 531503..531579 | + | 77 | NuclAT_11 | - | Antitoxin |
| - (531503) | 531503..531579 | + | 77 | NuclAT_11 | - | Antitoxin |
| - (531503) | 531503..531579 | + | 77 | NuclAT_11 | - | Antitoxin |
| PS041_RS02690 (531723) | 531723..534986 | - | 3264 | WP_273824879.1 | HsdR family type I site-specific deoxyribonuclease | - |
| PS041_RS02695 (535081) | 535081..536481 | - | 1401 | WP_059254411.1 | restriction endonuclease subunit S | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 114 a.a. Molecular weight: 12384.20 Da Isoelectric Point: 7.8219
>T271755 WP_044708303.1 NZ_CP117628:c531508-531167 [Escherichia albertii]
MTDTHSIAQPFEAEVSPANNRQLTVSYASRYPDYSRIPTITLKGQWLEAAGFATGTVVDVKVMEGCIVLTTQPPAAEESE
LMQSLRQVCKLSARKQKQVQEFIGVIAGKQKVA
MTDTHSIAQPFEAEVSPANNRQLTVSYASRYPDYSRIPTITLKGQWLEAAGFATGTVVDVKVMEGCIVLTTQPPAAEESE
LMQSLRQVCKLSARKQKQVQEFIGVIAGKQKVA
Download Length: 342 bp
Antitoxin
Download Length: 77 bp
>AT271755 NZ_CP117628:531503-531579 [Escherichia albertii]
AGTCATGATTACTATTCTCCATAAATAGTGATTGTGATGAGCGGTGCGGGTGTGTTGGCGCACATCCGCACCGCGCT
AGTCATGATTACTATTCTCCATAAATAGTGATTGTGATGAGCGGTGCGGGTGTGTTGGCGCACATCCGCACCGCGCT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|