Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | hok-sok/- |
| Location | 97244..97498 | Replicon | plasmid pEA24_2 |
| Accession | NZ_CP117622 | ||
| Organism | Escherichia albertii strain BIA_24 | ||
Toxin (Protein)
| Gene name | srnB | Uniprot ID | A0A148HBD8 |
| Locus tag | PS039_RS24855 | Protein ID | WP_001336447.1 |
| Coordinates | 97349..97498 (+) | Length | 50 a.a. |
Antitoxin (RNA)
| Gene name | srnC | ||
| Locus tag | - | ||
| Coordinates | 97244..97305 (-) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PS039_RS24825 (93599) | 93599..94345 | + | 747 | WP_273810588.1 | conjugal transfer pilus acetylase TraX | - |
| PS039_RS24830 (94400) | 94400..94960 | + | 561 | WP_273810619.1 | fertility inhibition protein FinO | - |
| PS039_RS24835 (95095) | 95095..95307 | + | 213 | WP_273810620.1 | hypothetical protein | - |
| PS039_RS24840 (95553) | 95553..96014 | + | 462 | WP_000978818.1 | thermonuclease family protein | - |
| PS039_RS24845 (96060) | 96060..96269 | + | 210 | WP_001299729.1 | hemolysin expression modulator Hha | - |
| PS039_RS24850 (96463) | 96463..96873 | + | 411 | WP_273810621.1 | hypothetical protein | - |
| - (97244) | 97244..97305 | - | 62 | NuclAT_0 | - | Antitoxin |
| - (97244) | 97244..97305 | - | 62 | NuclAT_0 | - | Antitoxin |
| - (97244) | 97244..97305 | - | 62 | NuclAT_0 | - | Antitoxin |
| - (97244) | 97244..97305 | - | 62 | NuclAT_0 | - | Antitoxin |
| PS039_RS24855 (97349) | 97349..97498 | + | 150 | WP_001336447.1 | Hok/Gef family protein | Toxin |
| PS039_RS24860 (97782) | 97782..98042 | + | 261 | WP_021536205.1 | replication regulatory protein RepA | - |
| PS039_RS24865 (98146) | 98146..98331 | + | 186 | WP_273810622.1 | plasmid copy control protein CopA | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Conjugative plasmid | - | - | 1..98343 | 98343 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 50 a.a. Molecular weight: 5572.69 Da Isoelectric Point: 8.7678
>T271751 WP_001336447.1 NZ_CP117622:97349-97498 [Escherichia albertii]
MTKYTLIGLLAVCATVLCFSLIFRERLCELNIHRGNTVVQVTLAYEARK
MTKYTLIGLLAVCATVLCFSLIFRERLCELNIHRGNTVVQVTLAYEARK
Download Length: 150 bp
Antitoxin
Download Length: 62 bp
>AT271751 NZ_CP117622:c97305-97244 [Escherichia albertii]
TTAAGGTACTTCATGCAGGCCTCACGAGTTAATGGATTAACAAGTGGGGTCTTCGCATTTCT
TTAAGGTACTTCATGCAGGCCTCACGAGTTAATGGATTAACAAGTGGGGTCTTCGCATTTCT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|