Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type I Classification (family/domain) hok-sok/-
Location 97244..97498 Replicon plasmid pEA24_2
Accession NZ_CP117622
Organism Escherichia albertii strain BIA_24

Toxin (Protein)


Gene name srnB Uniprot ID A0A148HBD8
Locus tag PS039_RS24855 Protein ID WP_001336447.1
Coordinates 97349..97498 (+) Length 50 a.a.

Antitoxin (RNA)


Gene name srnC
Locus tag -
Coordinates 97244..97305 (-)

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
PS039_RS24825 (93599) 93599..94345 + 747 WP_273810588.1 conjugal transfer pilus acetylase TraX -
PS039_RS24830 (94400) 94400..94960 + 561 WP_273810619.1 fertility inhibition protein FinO -
PS039_RS24835 (95095) 95095..95307 + 213 WP_273810620.1 hypothetical protein -
PS039_RS24840 (95553) 95553..96014 + 462 WP_000978818.1 thermonuclease family protein -
PS039_RS24845 (96060) 96060..96269 + 210 WP_001299729.1 hemolysin expression modulator Hha -
PS039_RS24850 (96463) 96463..96873 + 411 WP_273810621.1 hypothetical protein -
- (97244) 97244..97305 - 62 NuclAT_0 - Antitoxin
- (97244) 97244..97305 - 62 NuclAT_0 - Antitoxin
- (97244) 97244..97305 - 62 NuclAT_0 - Antitoxin
- (97244) 97244..97305 - 62 NuclAT_0 - Antitoxin
PS039_RS24855 (97349) 97349..97498 + 150 WP_001336447.1 Hok/Gef family protein Toxin
PS039_RS24860 (97782) 97782..98042 + 261 WP_021536205.1 replication regulatory protein RepA -
PS039_RS24865 (98146) 98146..98331 + 186 WP_273810622.1 plasmid copy control protein CopA -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Conjugative plasmid - - 1..98343 98343


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Hok/gef cell toxic protein

(4-45)


Sequences

Toxin        


Download         Length: 50 a.a.        Molecular weight: 5572.69 Da        Isoelectric Point: 8.7678

>T271751 WP_001336447.1 NZ_CP117622:97349-97498 [Escherichia albertii]
MTKYTLIGLLAVCATVLCFSLIFRERLCELNIHRGNTVVQVTLAYEARK

Download         Length: 150 bp

Antitoxin


Download         Length: 62 bp

>AT271751 NZ_CP117622:c97305-97244 [Escherichia albertii]
TTAAGGTACTTCATGCAGGCCTCACGAGTTAATGGATTAACAAGTGGGGTCTTCGCATTTCT

Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A148HBD8

Antitoxin

Download structure file

References