Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) ccdAB/CcdA(antitoxin)
Location 9315..9840 Replicon plasmid pEA24_1
Accession NZ_CP117621
Organism Escherichia albertii strain BIA_24

Toxin (Protein)


Gene name ccdB Uniprot ID S1PFV8
Locus tag PS039_RS23570 Protein ID WP_001159871.1
Coordinates 9315..9620 (-) Length 102 a.a.

Antitoxin (Protein)


Gene name ccdA Uniprot ID Q3ZU16
Locus tag PS039_RS23575 Protein ID WP_000813639.1
Coordinates 9622..9840 (-) Length 73 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
PS039_RS23535 (4972) 4972..5178 - 207 Protein_4 transposase -
PS039_RS23540 (5275) 5275..5484 + 210 Protein_5 DUF4113 domain-containing protein -
PS039_RS23545 (5486) 5486..5902 - 417 WP_273775112.1 plasmid partitioning/stability family protein -
PS039_RS23550 (5895) 5895..6875 - 981 WP_256878413.1 plasmid segregation protein ParM -
PS039_RS23555 (7287) 7287..7595 - 309 WP_000030204.1 molecular chaperone GroEL -
PS039_RS23560 (7682) 7682..8326 - 645 WP_001144036.1 ParA family protein -
PS039_RS23565 (8506) 8506..9314 - 809 Protein_10 site-specific integrase -
PS039_RS23570 (9315) 9315..9620 - 306 WP_001159871.1 type II toxin-antitoxin system toxin CcdB Toxin
PS039_RS23575 (9622) 9622..9840 - 219 WP_000813639.1 type II toxin-antitoxin system antitoxin CcdA Antitoxin
PS039_RS23580 (10313) 10313..11441 - 1129 Protein_13 IS3 family transposase -
PS039_RS23585 (11671) 11671..11844 + 174 Protein_14 transposase family protein -
PS039_RS23590 (11805) 11805..12772 - 968 Protein_15 integrase core domain-containing protein -
PS039_RS23595 (13603) 13603..14580 + 978 WP_000361611.1 RepB family plasmid replication initiator protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Conjugative plasmid - espL2 / espL2 / iucA / iucB / iucC / iucD / iutA / gspL / gspH / gspG / vat 1..136544 136544


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin CcdB

(2-100)

Antitoxin

Post-segregation antitoxin CcdA

(2-72)


Sequences

Toxin        


Download         Length: 102 a.a.        Molecular weight: 11692.49 Da        Isoelectric Point: 6.4674

>T271750 WP_001159871.1 NZ_CP117621:c9620-9315 [Escherichia albertii]
MQFKVYTYKRESRYRLFVDVQSDIIDTPGRRMVIPLASARLLSDKVSRELYPVVHVGDESWRMMTTDMASVPVSVIGEEV
ADLSHRENDIKNAINLMFWGI

Download         Length: 306 bp

Antitoxin


Download         Length: 73 a.a.        Molecular weight: 8372.30 Da        Isoelectric Point: 4.5203

>AT271750 WP_000813639.1 NZ_CP117621:c9840-9622 [Escherichia albertii]
MKQRITVTVDSDSYQLLKAYDVNISGLVSTTMQNEARRLRAERWQAENQEGMAEVARFIEMNGSFADENRDW

Download         Length: 219 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A829CCE8

Antitoxin

Source ID Structure
AlphaFold DB A0A7U9DIR5

References