Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type I Classification (family/domain) hok-sok/-
Location 4466847..4467104 Replicon chromosome
Accession NZ_CP117620
Organism Escherichia albertii strain BIA_24

Toxin (Protein)


Gene name hokA Uniprot ID V0YDF1
Locus tag PS039_RS21725 Protein ID WP_001135738.1
Coordinates 4466847..4466999 (-) Length 51 a.a.

Antitoxin (RNA)


Gene name sokA
Locus tag -
Coordinates 4467056..4467104 (+)

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
PS039_RS21695 4462952..4463611 + 660 WP_000747625.1 OmpA family lipoprotein -
PS039_RS21700 4463715..4464689 + 975 WP_000804993.1 glyoxylate/hydroxypyruvate reductase GhrB -
PS039_RS21705 4464742..4465452 - 711 WP_002460072.1 DUF3053 domain-containing protein -
PS039_RS21710 4465875..4466165 + 291 WP_000455794.1 HTH-type transcriptional regulator -
PS039_RS21715 4466448..4466660 + 213 WP_000014594.1 RNA chaperone/antiterminator CspA -
PS039_RS21720 4466799..4466870 + 72 WP_212743705.1 hypothetical protein -
PS039_RS21725 4466847..4466999 - 153 WP_001135738.1 type I toxin-antitoxin system toxin HokA Toxin
- 4467056..4467104 + 49 - - Antitoxin
PS039_RS21730 4467322..4469391 - 2070 WP_059221279.1 glycine--tRNA ligase subunit beta -
PS039_RS21735 4469401..4470312 - 912 WP_097496501.1 glycine--tRNA ligase subunit alpha -
PS039_RS21740 4470408..4470707 - 300 WP_000979961.1 YsaB family lipoprotein -
PS039_RS21745 4470880..4471875 + 996 WP_105228345.1 acyltransferase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Hok/gef cell toxic protein

(5-46)


Sequences

Toxin        


Download         Length: 51 a.a.        Molecular weight: 5912.14 Da        Isoelectric Point: 7.7173

>T271749 WP_001135738.1 NZ_CP117620:c4466999-4466847 [Escherichia albertii]
MPQKYRLLSLIVICFTLLFFTWMIRDSLCELHIKQGSYELAAFLACNLKE

Download         Length: 153 bp

Antitoxin


Download         Length: 49 bp

>AT271749 NZ_CP117620:4467056-4467104 [Escherichia albertii]
GCATAGAGGGGCCTCACTTTGATTTATAGTCAGGTGGGGCTTTTCTCTG

Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A7U9LX93

Antitoxin

Download structure file

References