Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | prlF-yhaV (relBE)/YhaV-PrlF |
| Location | 4034733..4035532 | Replicon | chromosome |
| Accession | NZ_CP117620 | ||
| Organism | Escherichia albertii strain BIA_24 | ||
Toxin (Protein)
| Gene name | yhaV | Uniprot ID | A0A8H9C2I0 |
| Locus tag | PS039_RS19510 | Protein ID | WP_059227548.1 |
| Coordinates | 4035068..4035532 (+) | Length | 155 a.a. |
Antitoxin (Protein)
| Gene name | prlF | Uniprot ID | S1PPV5 |
| Locus tag | PS039_RS19505 | Protein ID | WP_001296435.1 |
| Coordinates | 4034733..4035068 (+) | Length | 112 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PS039_RS19490 (4030522) | 4030522..4031292 | - | 771 | WP_001058056.1 | 2-dehydro-3-deoxyglucarate aldolase | - |
| PS039_RS19495 (4031308) | 4031308..4032642 | - | 1335 | WP_273809737.1 | galactarate/glucarate/glycerate transporter GarP | - |
| PS039_RS19500 (4033013) | 4033013..4034584 | + | 1572 | WP_273809738.1 | galactarate dehydratase | - |
| PS039_RS19505 (4034733) | 4034733..4035068 | + | 336 | WP_001296435.1 | type II toxin-antitoxin system antitoxin PrlF | Antitoxin |
| PS039_RS19510 (4035068) | 4035068..4035532 | + | 465 | WP_059227548.1 | type II toxin-antitoxin system ribonuclease toxin YhaV | Toxin |
| PS039_RS19515 (4035587) | 4035587..4036396 | - | 810 | WP_000072169.1 | aga operon transcriptional regulator AgaR | - |
| PS039_RS19520 (4036645) | 4036645..4037925 | + | 1281 | WP_059235447.1 | tagatose-bisphosphate aldolase subunit KbaZ | - |
| PS039_RS19525 (4037948) | 4037948..4038421 | + | 474 | WP_002461030.1 | PTS N-acetylgalactosamine transporter subunit IIB | - |
| PS039_RS19530 (4038432) | 4038432..4039211 | + | 780 | WP_000406226.1 | PTS N-acetylgalactosamine transporter subunit IIC | - |
| PS039_RS19535 (4039201) | 4039201..4040079 | + | 879 | WP_001295548.1 | PTS N-acetylgalactosamine transporter subunit IID | - |
| PS039_RS19540 (4040097) | 4040097..4040531 | + | 435 | WP_000948824.1 | PTS galactosamine/N-acetylgalactosamine transporter subunit IIA | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 155 a.a. Molecular weight: 17819.26 Da Isoelectric Point: 9.7301
>T271746 WP_059227548.1 NZ_CP117620:4035068-4035532 [Escherichia albertii]
MDFPQRVNGWALYAHPCFQETYDALVAEVETLKGKDPENYQRKAATKLLAVVHKVIEEHITVNPSSPAFRHGKSLGSGKN
KDWSRVKFGAGRFRLFFRYSEKEKVIILGWMNDENTLRTYGKKTDAYTVFSKMLKRGHPPADWETLTQETEEKH
MDFPQRVNGWALYAHPCFQETYDALVAEVETLKGKDPENYQRKAATKLLAVVHKVIEEHITVNPSSPAFRHGKSLGSGKN
KDWSRVKFGAGRFRLFFRYSEKEKVIILGWMNDENTLRTYGKKTDAYTVFSKMLKRGHPPADWETLTQETEEKH
Download Length: 465 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|