Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | hok-sok/- |
Location | 3528561..3528807 | Replicon | chromosome |
Accession | NZ_CP117620 | ||
Organism | Escherichia albertii strain BIA_24 |
Toxin (Protein)
Gene name | hokX | Uniprot ID | S1PD89 |
Locus tag | PS039_RS17140 | Protein ID | WP_000956458.1 |
Coordinates | 3528561..3528713 (-) | Length | 51 a.a. |
Antitoxin (RNA)
Gene name | sokX | ||
Locus tag | - | ||
Coordinates | 3528755..3528807 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PS039_RS17115 | 3523829..3524152 | - | 324 | WP_273809518.1 | DUF3561 family protein | - |
PS039_RS17120 | 3524202..3524807 | - | 606 | WP_024164993.1 | adenylyl-sulfate kinase | - |
PS039_RS17125 | 3524807..3526234 | - | 1428 | WP_141109490.1 | sulfate adenylyltransferase subunit CysN | - |
PS039_RS17130 | 3526236..3527144 | - | 909 | WP_000372386.1 | sulfate adenylyltransferase subunit CysD | - |
PS039_RS17135 | 3527398..3528435 | + | 1038 | WP_059268554.1 | alkaline phosphatase isozyme conversion aminopeptidase | - |
PS039_RS17140 | 3528561..3528713 | - | 153 | WP_000956458.1 | Hok/Gef family protein | Toxin |
- | 3528755..3528807 | + | 53 | - | - | Antitoxin |
PS039_RS17145 | 3528978..3529712 | - | 735 | WP_001125132.1 | phosphoadenosine phosphosulfate reductase | - |
PS039_RS17150 | 3529892..3531604 | - | 1713 | WP_059273794.1 | assimilatory sulfite reductase (NADPH) hemoprotein subunit | - |
PS039_RS17155 | 3531604..3533403 | - | 1800 | WP_273809520.1 | NADPH-dependent assimilatory sulfite reductase flavoprotein subunit | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 51 a.a. Molecular weight: 5558.77 Da Isoelectric Point: 7.6757
>T271743 WP_000956458.1 NZ_CP117620:c3528713-3528561 [Escherichia albertii]
MLTKYALVAIIVLCCTVLGFTLMVGDSLCELSIRERGMEFKAVLAYESKK
MLTKYALVAIIVLCCTVLGFTLMVGDSLCELSIRERGMEFKAVLAYESKK
Download Length: 153 bp
Antitoxin
Download Length: 53 bp
>AT271743 NZ_CP117620:3528755-3528807 [Escherichia albertii]
TTAGGTTCGAACGCTGGCCTCAGGTTGATAGAAATATCGCCTGGGGCTTTTGT
TTAGGTTCGAACGCTGGCCTCAGGTTGATAGAAATATCGCCTGGGGCTTTTGT
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|