Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/HigB-HigA |
Location | 2200515..2201077 | Replicon | chromosome |
Accession | NZ_CP117620 | ||
Organism | Escherichia albertii strain BIA_24 |
Toxin (Protein)
Gene name | higB | Uniprot ID | A0A8H9EY56 |
Locus tag | PS039_RS10570 | Protein ID | WP_059219270.1 |
Coordinates | 2200799..2201077 (-) | Length | 93 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | S1PAQ1 |
Locus tag | PS039_RS10565 | Protein ID | WP_000781370.1 |
Coordinates | 2200515..2200799 (-) | Length | 95 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PS039_RS10550 (2195697) | 2195697..2198744 | + | 3048 | WP_077776584.1 | formate dehydrogenase-N subunit alpha | - |
PS039_RS10555 (2198757) | 2198757..2199641 | + | 885 | WP_001240583.1 | formate dehydrogenase N subunit beta | - |
PS039_RS10560 (2199634) | 2199634..2200287 | + | 654 | WP_000045636.1 | formate dehydrogenase-N subunit gamma | - |
PS039_RS10565 (2200515) | 2200515..2200799 | - | 285 | WP_000781370.1 | HigA family addiction module antitoxin | Antitoxin |
PS039_RS10570 (2200799) | 2200799..2201077 | - | 279 | WP_059219270.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
PS039_RS10575 (2201263) | 2201263..2202273 | - | 1011 | WP_059219269.1 | alcohol dehydrogenase AdhP | - |
PS039_RS10580 (2202408) | 2202408..2204105 | - | 1698 | WP_000433442.1 | malate dehydrogenase | - |
PS039_RS10585 (2204262) | 2204262..2204399 | - | 138 | WP_000841563.1 | stationary-phase-induced ribosome-associated protein | - |
PS039_RS10590 (2204666) | 2204666..2205097 | + | 432 | WP_000152289.1 | peroxiredoxin OsmC | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 93 a.a. Molecular weight: 10505.04 Da Isoelectric Point: 7.3995
>T271737 WP_059219270.1 NZ_CP117620:c2201077-2200799 [Escherichia albertii]
MIMNFRHKGLRDLFLLGKTSGVIPTQVKRLRHRLAVIDAASSLADIDMPGYRLHPLSGDRDGIWAISVSGNWRITFEFVN
GDAYILDYEDYH
MIMNFRHKGLRDLFLLGKTSGVIPTQVKRLRHRLAVIDAASSLADIDMPGYRLHPLSGDRDGIWAISVSGNWRITFEFVN
GDAYILDYEDYH
Download Length: 279 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|---|---|
PDB | 2ICT | |
PDB | 2ICP | |
AlphaFold DB | A0A829CUG6 |