Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type I Classification (family/domain) hok-sok/-
Location 1804313..1804538 Replicon chromosome
Accession NZ_CP117620
Organism Escherichia albertii strain BIA_24

Toxin (Protein)


Gene name hokW Uniprot ID A0A7L6L988
Locus tag PS039_RS08560 Protein ID WP_000813269.1
Coordinates 1804383..1804538 (+) Length 52 a.a.

Antitoxin (RNA)


Gene name sokW
Locus tag -
Coordinates 1804313..1804371 (-)

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
PS039_RS08535 1799761..1800693 + 933 WP_273810461.1 helix-turn-helix domain-containing protein -
PS039_RS08540 1800700..1801446 + 747 WP_273810462.1 ATP-binding protein -
PS039_RS08545 1801469..1802230 + 762 WP_059217918.1 DUF1627 domain-containing protein -
PS039_RS08550 1802238..1802648 + 411 WP_137651310.1 DUF977 family protein -
PS039_RS08555 1803005..1803778 - 774 WP_059217920.1 alpha/beta hydrolase -
- 1804313..1804371 - 59 - - Antitoxin
PS039_RS08560 1804383..1804538 + 156 WP_000813269.1 type I toxin-antitoxin system toxin HokD Toxin
PS039_RS08565 1804706..1804984 + 279 WP_137651311.1 hypothetical protein -
PS039_RS08570 1804986..1806041 + 1056 WP_273810463.1 DUF968 domain-containing protein -
PS039_RS08575 1806042..1806419 + 378 Protein_1662 RusA family crossover junction endodeoxyribonuclease -
PS039_RS08580 1806409..1806777 + 369 WP_021526745.1 antiterminator Q family protein -
PS039_RS08585 1806813..1807211 - 399 WP_024190350.1 hypothetical protein -
PS039_RS08590 1807201..1807464 - 264 WP_021526743.1 hypothetical protein -
PS039_RS08595 1807480..1808361 - 882 WP_021526742.1 hypothetical protein -
PS039_RS08620 1809259..1809336 + 78 Protein_1667 phage holin -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Prophage - espW / espW / espM2 1787879..1840730 52851


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Hok/gef cell toxic protein

(6-47)


Sequences

Toxin        


Download         Length: 52 a.a.        Molecular weight: 5722.86 Da        Isoelectric Point: 6.1531

>T271732 WP_000813269.1 NZ_CP117620:1804383-1804538 [Escherichia albertii]
MKQQKAMLVALIVICLTVIVTALVTRKDLCEVRIRTGQTEVAVFTAYEPEE

Download         Length: 156 bp

Antitoxin


Download         Length: 59 bp

>AT271732 NZ_CP117620:c1804371-1804313 [Escherichia albertii]
CCTTGCCTTTCGGCACGTAAGAGGCTAACCTACATGTGTCTAGCATGAAATTGGCCTCA

Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A7L6L988

Antitoxin

Download structure file

References