Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | hok-sok/- |
| Location | 1804313..1804538 | Replicon | chromosome |
| Accession | NZ_CP117620 | ||
| Organism | Escherichia albertii strain BIA_24 | ||
Toxin (Protein)
| Gene name | hokW | Uniprot ID | A0A7L6L988 |
| Locus tag | PS039_RS08560 | Protein ID | WP_000813269.1 |
| Coordinates | 1804383..1804538 (+) | Length | 52 a.a. |
Antitoxin (RNA)
| Gene name | sokW | ||
| Locus tag | - | ||
| Coordinates | 1804313..1804371 (-) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PS039_RS08535 | 1799761..1800693 | + | 933 | WP_273810461.1 | helix-turn-helix domain-containing protein | - |
| PS039_RS08540 | 1800700..1801446 | + | 747 | WP_273810462.1 | ATP-binding protein | - |
| PS039_RS08545 | 1801469..1802230 | + | 762 | WP_059217918.1 | DUF1627 domain-containing protein | - |
| PS039_RS08550 | 1802238..1802648 | + | 411 | WP_137651310.1 | DUF977 family protein | - |
| PS039_RS08555 | 1803005..1803778 | - | 774 | WP_059217920.1 | alpha/beta hydrolase | - |
| - | 1804313..1804371 | - | 59 | - | - | Antitoxin |
| PS039_RS08560 | 1804383..1804538 | + | 156 | WP_000813269.1 | type I toxin-antitoxin system toxin HokD | Toxin |
| PS039_RS08565 | 1804706..1804984 | + | 279 | WP_137651311.1 | hypothetical protein | - |
| PS039_RS08570 | 1804986..1806041 | + | 1056 | WP_273810463.1 | DUF968 domain-containing protein | - |
| PS039_RS08575 | 1806042..1806419 | + | 378 | Protein_1662 | RusA family crossover junction endodeoxyribonuclease | - |
| PS039_RS08580 | 1806409..1806777 | + | 369 | WP_021526745.1 | antiterminator Q family protein | - |
| PS039_RS08585 | 1806813..1807211 | - | 399 | WP_024190350.1 | hypothetical protein | - |
| PS039_RS08590 | 1807201..1807464 | - | 264 | WP_021526743.1 | hypothetical protein | - |
| PS039_RS08595 | 1807480..1808361 | - | 882 | WP_021526742.1 | hypothetical protein | - |
| PS039_RS08620 | 1809259..1809336 | + | 78 | Protein_1667 | phage holin | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Prophage | - | espW / espW / espM2 | 1787879..1840730 | 52851 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 52 a.a. Molecular weight: 5722.86 Da Isoelectric Point: 6.1531
>T271732 WP_000813269.1 NZ_CP117620:1804383-1804538 [Escherichia albertii]
MKQQKAMLVALIVICLTVIVTALVTRKDLCEVRIRTGQTEVAVFTAYEPEE
MKQQKAMLVALIVICLTVIVTALVTRKDLCEVRIRTGQTEVAVFTAYEPEE
Download Length: 156 bp
Antitoxin
Download Length: 59 bp
>AT271732 NZ_CP117620:c1804371-1804313 [Escherichia albertii]
CCTTGCCTTTCGGCACGTAAGAGGCTAACCTACATGTGTCTAGCATGAAATTGGCCTCA
CCTTGCCTTTCGGCACGTAAGAGGCTAACCTACATGTGTCTAGCATGAAATTGGCCTCA
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|