Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | Hha-TomB/- |
| Location | 1091021..1091639 | Replicon | chromosome |
| Accession | NZ_CP117620 | ||
| Organism | Escherichia albertii strain BIA_24 | ||
Toxin (Protein)
| Gene name | Hha | Uniprot ID | V1H8E6 |
| Locus tag | PS039_RS05180 | Protein ID | WP_001280991.1 |
| Coordinates | 1091021..1091239 (-) | Length | 73 a.a. |
Antitoxin (Protein)
| Gene name | TomB | Uniprot ID | B1EKM5 |
| Locus tag | PS039_RS05185 | Protein ID | WP_000344798.1 |
| Coordinates | 1091265..1091639 (-) | Length | 125 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PS039_RS05145 (1086310) | 1086310..1086882 | + | 573 | WP_000779847.1 | YbaY family lipoprotein | - |
| PS039_RS05150 (1086912) | 1086912..1087223 | - | 312 | WP_273810347.1 | MGMT family protein | - |
| PS039_RS05160 (1087604) | 1087604..1087957 | + | 354 | WP_000878151.1 | DUF1428 family protein | - |
| PS039_RS05165 (1087995) | 1087995..1089545 | - | 1551 | WP_001260378.1 | EAL domain-containing protein | - |
| PS039_RS05170 (1089709) | 1089709..1090179 | - | 471 | WP_000136188.1 | YlaC family protein | - |
| PS039_RS05175 (1090287) | 1090287..1090844 | - | 558 | WP_025237467.1 | maltose O-acetyltransferase | - |
| PS039_RS05180 (1091021) | 1091021..1091239 | - | 219 | WP_001280991.1 | HHA domain-containing protein | Toxin |
| PS039_RS05185 (1091265) | 1091265..1091639 | - | 375 | WP_000344798.1 | Hha toxicity modulator TomB | Antitoxin |
| PS039_RS05190 (1092194) | 1092194..1095343 | - | 3150 | WP_273810348.1 | efflux RND transporter permease AcrB | - |
| PS039_RS05195 (1095366) | 1095366..1096559 | - | 1194 | WP_010334435.1 | multidrug efflux RND transporter periplasmic adaptor subunit AcrA | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 73 a.a. Molecular weight: 8613.97 Da Isoelectric Point: 8.9008
>T271731 WP_001280991.1 NZ_CP117620:c1091239-1091021 [Escherichia albertii]
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
Download Length: 219 bp
Antitoxin
Download Length: 125 a.a. Molecular weight: 14499.35 Da Isoelectric Point: 4.8989
>AT271731 WP_000344798.1 NZ_CP117620:c1091639-1091265 [Escherichia albertii]
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAINLQLNELIEHIATFALNYKIKYNEDNKLIEQIDEYL
DDTFMLFSSYGINMQDLQKWRKSGNRLFRCFVNATKANPASLSC
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAINLQLNELIEHIATFALNYKIKYNEDNKLIEQIDEYL
DDTFMLFSSYGINMQDLQKWRKSGNRLFRCFVNATKANPASLSC
Download Length: 375 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|