Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | hok-sok/- |
Location | 642464..642722 | Replicon | chromosome |
Accession | NZ_CP117620 | ||
Organism | Escherichia albertii strain BIA_24 |
Toxin (Protein)
Gene name | hokC | Uniprot ID | S1NX00 |
Locus tag | PS039_RS03085 | Protein ID | WP_000809168.1 |
Coordinates | 642464..642616 (-) | Length | 51 a.a. |
Antitoxin (RNA)
Gene name | sokC | ||
Locus tag | - | ||
Coordinates | 642665..642722 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PS039_RS03065 | 637702..638415 | - | 714 | WP_001102345.1 | acidic protein MsyB | - |
PS039_RS03070 | 638442..638846 | - | 405 | WP_000833521.1 | DUF2541 family protein | - |
PS039_RS03075 | 639221..641137 | + | 1917 | WP_000516135.1 | molecular chaperone DnaK | - |
PS039_RS03080 | 641226..642356 | + | 1131 | WP_273810195.1 | molecular chaperone DnaJ | - |
PS039_RS03085 | 642464..642616 | - | 153 | WP_000809168.1 | type I toxin-antitoxin system toxin MokC | Toxin |
- | 642665..642722 | + | 58 | - | - | Antitoxin |
PS039_RS03090 | 643239..644000 | + | 762 | WP_001276206.1 | outer membrane protein OmpK | - |
PS039_RS03095 | 644021..645514 | + | 1494 | WP_059214855.1 | sulfatase-like hydrolase/transferase | - |
PS039_RS03100 | 645668..646915 | + | 1248 | WP_273810197.1 | cytoplasmic protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 51 a.a. Molecular weight: 5501.57 Da Isoelectric Point: 7.1312
>T271729 WP_000809168.1 NZ_CP117620:c642616-642464 [Escherichia albertii]
MKQHKAMIVALIVICITAVVAALVTRKDLCEVHIRTGQTEVAVFTAYESE
MKQHKAMIVALIVICITAVVAALVTRKDLCEVHIRTGQTEVAVFTAYESE
Download Length: 153 bp
Antitoxin
Download Length: 58 bp
>AT271729 NZ_CP117620:642665-642722 [Escherichia albertii]
GTTCTGCATATAGGGGGCCTCGGGTTGATGGTAAAATATCACTCGGGGCTTTTCTCTA
GTTCTGCATATAGGGGGCCTCGGGTTGATGGTAAAATATCACTCGGGGCTTTTCTCTA
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|