Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | symE-sokC/SymE(toxin) |
Location | 566757..567169 | Replicon | chromosome |
Accession | NZ_CP117620 | ||
Organism | Escherichia albertii strain BIA_24 |
Toxin (Protein)
Gene name | symE | Uniprot ID | A0A8D9PK47 |
Locus tag | PS039_RS02715 | Protein ID | WP_000132619.1 |
Coordinates | 566757..567098 (-) | Length | 114 a.a. |
Antitoxin (RNA)
Gene name | sokC | ||
Locus tag | - | ||
Coordinates | 567093..567169 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PS039_RS02695 (561789) | 561789..562721 | + | 933 | WP_054409949.1 | Rpn family recombination-promoting nuclease/putative transposase | - |
PS039_RS02700 (563036) | 563036..564114 | + | 1079 | Protein_521 | DUF1998 domain-containing protein | - |
PS039_RS02705 (564170) | 564170..565216 | - | 1047 | WP_072252312.1 | 5-methylcytosine-specific restriction endonuclease system specificity protein McrC | - |
PS039_RS02710 (565216) | 565216..566595 | - | 1380 | WP_059217670.1 | 5-methylcytosine-specific restriction endonuclease subunit McrB | - |
PS039_RS02715 (566757) | 566757..567098 | - | 342 | WP_000132619.1 | endoribonuclease SymE | Toxin |
- (567093) | 567093..567169 | + | 77 | NuclAT_6 | - | Antitoxin |
- (567093) | 567093..567169 | + | 77 | NuclAT_6 | - | Antitoxin |
- (567093) | 567093..567169 | + | 77 | NuclAT_6 | - | Antitoxin |
- (567093) | 567093..567169 | + | 77 | NuclAT_6 | - | Antitoxin |
- (567093) | 567093..567169 | + | 77 | NuclAT_7 | - | Antitoxin |
- (567093) | 567093..567169 | + | 77 | NuclAT_7 | - | Antitoxin |
- (567093) | 567093..567169 | + | 77 | NuclAT_7 | - | Antitoxin |
- (567093) | 567093..567169 | + | 77 | NuclAT_7 | - | Antitoxin |
PS039_RS02720 (567319) | 567319..569094 | - | 1776 | WP_273810174.1 | restriction endonuclease subunit S | - |
PS039_RS02725 (569094) | 569094..570563 | - | 1470 | WP_273810175.1 | N-6 DNA methylase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 114 a.a. Molecular weight: 12322.13 Da Isoelectric Point: 7.8219
>T271725 WP_000132619.1 NZ_CP117620:c567098-566757 [Escherichia albertii]
MTDTHSIAQPFEAEVSPANNRQLTVSYASRYPDYSRIPAITLKGQWLEAAGFATGTAVDVKVMEGCIVLTAQPPAPEESE
LMQSLRQVCKLSARKQKQVQEFIGVIAGKQKVA
MTDTHSIAQPFEAEVSPANNRQLTVSYASRYPDYSRIPAITLKGQWLEAAGFATGTAVDVKVMEGCIVLTAQPPAPEESE
LMQSLRQVCKLSARKQKQVQEFIGVIAGKQKVA
Download Length: 342 bp
Antitoxin
Download Length: 77 bp
>AT271725 NZ_CP117620:567093-567169 [Escherichia albertii]
AGTCATAACTGCTATTCTCCGATAATAGTGATTGTGATGAGCGGTGCGGGTGTGTTGGCGCACATCCGCACCGCGCT
AGTCATAACTGCTATTCTCCGATAATAGTGATTGTGATGAGCGGTGCGGGTGTGTTGGCGCACATCCGCACCGCGCT
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|