Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | symE-OrzO/SymE(toxin) |
| Location | 3877977..3878389 | Replicon | chromosome |
| Accession | NZ_CP117609 | ||
| Organism | Escherichia albertii strain BIA_26 | ||
Toxin (Protein)
| Gene name | symE | Uniprot ID | A0A7U8ZC55 |
| Locus tag | PS038_RS18570 | Protein ID | WP_025237738.1 |
| Coordinates | 3878048..3878389 (+) | Length | 114 a.a. |
Antitoxin (RNA)
| Gene name | OrzO | ||
| Locus tag | - | ||
| Coordinates | 3877977..3878053 (-) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PS038_RS18560 (3874894) | 3874894..3876483 | + | 1590 | WP_059218507.1 | type I restriction-modification system methyltransferase | - |
| PS038_RS18565 (3876480) | 3876480..3877820 | + | 1341 | WP_059218508.1 | restriction endonuclease subunit S | - |
| - (3877977) | 3877977..3878053 | - | 77 | NuclAT_6 | - | Antitoxin |
| - (3877977) | 3877977..3878053 | - | 77 | NuclAT_6 | - | Antitoxin |
| - (3877977) | 3877977..3878053 | - | 77 | NuclAT_6 | - | Antitoxin |
| - (3877977) | 3877977..3878053 | - | 77 | NuclAT_6 | - | Antitoxin |
| - (3877977) | 3877977..3878053 | - | 77 | NuclAT_7 | - | Antitoxin |
| - (3877977) | 3877977..3878053 | - | 77 | NuclAT_7 | - | Antitoxin |
| - (3877977) | 3877977..3878053 | - | 77 | NuclAT_7 | - | Antitoxin |
| - (3877977) | 3877977..3878053 | - | 77 | NuclAT_7 | - | Antitoxin |
| PS038_RS18570 (3878048) | 3878048..3878389 | + | 342 | WP_025237738.1 | endoribonuclease SymE | Toxin |
| PS038_RS18575 (3878551) | 3878551..3879930 | + | 1380 | WP_059218509.1 | 5-methylcytosine-specific restriction endonuclease subunit McrB | - |
| PS038_RS18580 (3879930) | 3879930..3880976 | + | 1047 | WP_072248752.1 | 5-methylcytosine-specific restriction endonuclease system specificity protein McrC | - |
| PS038_RS18585 (3881032) | 3881032..3882110 | - | 1079 | Protein_3631 | DUF1998 domain-containing protein | - |
| PS038_RS18590 (3882427) | 3882427..3883359 | - | 933 | WP_273818182.1 | Rpn family recombination-promoting nuclease/putative transposase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 114 a.a. Molecular weight: 12310.12 Da Isoelectric Point: 7.8219
>T271689 WP_025237738.1 NZ_CP117609:3878048-3878389 [Escherichia albertii]
MTDTHSIAQPFEAEVSPANNRQLTVSYASRYPDYSRIPAITLKGQWLEAAGFATGTAIDVKVMEGCIVLTAQPPAAEESE
LMQSLRQVCKLSARKQKQVQEFIGVIAGKQKVA
MTDTHSIAQPFEAEVSPANNRQLTVSYASRYPDYSRIPAITLKGQWLEAAGFATGTAIDVKVMEGCIVLTAQPPAAEESE
LMQSLRQVCKLSARKQKQVQEFIGVIAGKQKVA
Download Length: 342 bp
Antitoxin
Download Length: 77 bp
>AT271689 NZ_CP117609:c3878053-3877977 [Escherichia albertii]
AGTCATGATTACTATTCTCCATAAATAGTGATTGTGATGAGCGGTGCGGGTGTGTTGGCGCACATCCGCACCGCGCT
AGTCATGATTACTATTCTCCATAAATAGTGATTGTGATGAGCGGTGCGGGTGTGTTGGCGCACATCCGCACCGCGCT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|