Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type I Classification (family/domain) hok-sok/-
Location 166804..167061 Replicon chromosome
Accession NZ_CP117609
Organism Escherichia albertii strain BIA_26

Toxin (Protein)


Gene name hokA Uniprot ID V0YDF1
Locus tag PS038_RS00755 Protein ID WP_001135738.1
Coordinates 166909..167061 (+) Length 51 a.a.

Antitoxin (RNA)


Gene name sokA
Locus tag -
Coordinates 166804..166858 (-)

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
PS038_RS00735 162033..163028 - 996 WP_059219155.1 acyltransferase -
PS038_RS00740 163201..163500 + 300 WP_000979961.1 YsaB family lipoprotein -
PS038_RS00745 163596..164507 + 912 WP_001168544.1 glycine--tRNA ligase subunit alpha -
PS038_RS00750 164517..166586 + 2070 WP_059219154.1 glycine--tRNA ligase subunit beta -
- 166804..166858 - 55 - - Antitoxin
PS038_RS00755 166909..167061 + 153 WP_001135738.1 type I toxin-antitoxin system toxin HokA Toxin
PS038_RS00760 167038..167109 - 72 WP_212734940.1 hypothetical protein -
PS038_RS00765 167249..167461 - 213 WP_000014594.1 RNA chaperone/antiterminator CspA -
PS038_RS00770 167744..168034 - 291 WP_000455794.1 HTH-type transcriptional regulator -
PS038_RS00775 168457..169167 + 711 WP_002460072.1 DUF3053 domain-containing protein -
PS038_RS00780 169220..170194 - 975 WP_000804993.1 glyoxylate/hydroxypyruvate reductase GhrB -
PS038_RS00785 170298..170957 - 660 WP_000747625.1 OmpA family lipoprotein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Hok/gef cell toxic protein

(5-46)


Sequences

Toxin        


Download         Length: 51 a.a.        Molecular weight: 5912.14 Da        Isoelectric Point: 7.7173

>T271673 WP_001135738.1 NZ_CP117609:166909-167061 [Escherichia albertii]
MPQKYRLLSLIVICFTLLFFTWMIRDSLCELHIKQGSYELAAFLACNLKE

Download         Length: 153 bp

Antitoxin


Download         Length: 55 bp

>AT271673 NZ_CP117609:c166858-166804 [Escherichia albertii]
GTTCAGGCATAGGGTAGCCTCACTTTGATTTATAGTCAGGTGGGGCTTTTCTCTG

Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A7U9LX93

Antitoxin

Download structure file

References