Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | hok-sok/- |
| Location | 166804..167061 | Replicon | chromosome |
| Accession | NZ_CP117609 | ||
| Organism | Escherichia albertii strain BIA_26 | ||
Toxin (Protein)
| Gene name | hokA | Uniprot ID | V0YDF1 |
| Locus tag | PS038_RS00755 | Protein ID | WP_001135738.1 |
| Coordinates | 166909..167061 (+) | Length | 51 a.a. |
Antitoxin (RNA)
| Gene name | sokA | ||
| Locus tag | - | ||
| Coordinates | 166804..166858 (-) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PS038_RS00735 | 162033..163028 | - | 996 | WP_059219155.1 | acyltransferase | - |
| PS038_RS00740 | 163201..163500 | + | 300 | WP_000979961.1 | YsaB family lipoprotein | - |
| PS038_RS00745 | 163596..164507 | + | 912 | WP_001168544.1 | glycine--tRNA ligase subunit alpha | - |
| PS038_RS00750 | 164517..166586 | + | 2070 | WP_059219154.1 | glycine--tRNA ligase subunit beta | - |
| - | 166804..166858 | - | 55 | - | - | Antitoxin |
| PS038_RS00755 | 166909..167061 | + | 153 | WP_001135738.1 | type I toxin-antitoxin system toxin HokA | Toxin |
| PS038_RS00760 | 167038..167109 | - | 72 | WP_212734940.1 | hypothetical protein | - |
| PS038_RS00765 | 167249..167461 | - | 213 | WP_000014594.1 | RNA chaperone/antiterminator CspA | - |
| PS038_RS00770 | 167744..168034 | - | 291 | WP_000455794.1 | HTH-type transcriptional regulator | - |
| PS038_RS00775 | 168457..169167 | + | 711 | WP_002460072.1 | DUF3053 domain-containing protein | - |
| PS038_RS00780 | 169220..170194 | - | 975 | WP_000804993.1 | glyoxylate/hydroxypyruvate reductase GhrB | - |
| PS038_RS00785 | 170298..170957 | - | 660 | WP_000747625.1 | OmpA family lipoprotein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 51 a.a. Molecular weight: 5912.14 Da Isoelectric Point: 7.7173
>T271673 WP_001135738.1 NZ_CP117609:166909-167061 [Escherichia albertii]
MPQKYRLLSLIVICFTLLFFTWMIRDSLCELHIKQGSYELAAFLACNLKE
MPQKYRLLSLIVICFTLLFFTWMIRDSLCELHIKQGSYELAAFLACNLKE
Download Length: 153 bp
Antitoxin
Download Length: 55 bp
>AT271673 NZ_CP117609:c166858-166804 [Escherichia albertii]
GTTCAGGCATAGGGTAGCCTCACTTTGATTTATAGTCAGGTGGGGCTTTTCTCTG
GTTCAGGCATAGGGTAGCCTCACTTTGATTTATAGTCAGGTGGGGCTTTTCTCTG
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|