Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | phd-doc/Doc-RelB |
| Location | 1281288..1281892 | Replicon | chromosome |
| Accession | NZ_CP117606 | ||
| Organism | Escherichia albertii strain BIA_29 | ||
Toxin (Protein)
| Gene name | doc | Uniprot ID | B1EM00 |
| Locus tag | PS031_RS06190 | Protein ID | WP_000638401.1 |
| Coordinates | 1281288..1281674 (-) | Length | 129 a.a. |
Antitoxin (Protein)
| Gene name | phd | Uniprot ID | B1ELZ9 |
| Locus tag | PS031_RS06195 | Protein ID | WP_001195490.1 |
| Coordinates | 1281671..1281892 (-) | Length | 74 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PS031_RS06170 (1277903) | 1277903..1279063 | - | 1161 | WP_059236629.1 | anaerobic sulfatase maturase | - |
| PS031_RS06175 (1279117) | 1279117..1279554 | - | 438 | Protein_1207 | sulfatase | - |
| PS031_RS06180 (1279836) | 1279836..1280144 | + | 309 | WP_273772611.1 | autotransporter outer membrane beta-barrel domain-containing protein | - |
| PS031_RS06185 (1280135) | 1280135..1281208 | + | 1074 | Protein_1209 | autotransporter outer membrane beta-barrel domain-containing protein | - |
| PS031_RS06190 (1281288) | 1281288..1281674 | - | 387 | WP_000638401.1 | type II toxin-antitoxin system death-on-curing family toxin | Toxin |
| PS031_RS06195 (1281671) | 1281671..1281892 | - | 222 | WP_001195490.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | Antitoxin |
| PS031_RS06200 (1281989) | 1281989..1282870 | - | 882 | WP_204629406.1 | LysR family transcriptional regulator | - |
| PS031_RS06205 (1282971) | 1282971..1284359 | + | 1389 | WP_098401985.1 | succinate-semialdehyde dehydrogenase | - |
| PS031_RS06210 (1284423) | 1284423..1285349 | + | 927 | WP_000257427.1 | glutaminase B | - |
| PS031_RS06215 (1285349) | 1285349..1285711 | + | 363 | WP_001257078.1 | DUF4186 domain-containing protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 129 a.a. Molecular weight: 14505.49 Da Isoelectric Point: 8.0833
>T271649 WP_000638401.1 NZ_CP117606:c1281674-1281288 [Escherichia albertii]
MIWVSAQEVIAFHDRILQRFPGVAGLTDPGRAQALIYRVQNRVHYEGVTDLFELAATYWVAIARGHIFHDGNKRTAFFVT
MTFLWRNGIRIRDVDNSLENLTVEAATGEKTVGQLARCLRERVDSSGN
MIWVSAQEVIAFHDRILQRFPGVAGLTDPGRAQALIYRVQNRVHYEGVTDLFELAATYWVAIARGHIFHDGNKRTAFFVT
MTFLWRNGIRIRDVDNSLENLTVEAATGEKTVGQLARCLRERVDSSGN
Download Length: 387 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A3T5VDW2 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A2S6PD20 |