Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/HigB-HigA |
| Location | 1263577..1264139 | Replicon | chromosome |
| Accession | NZ_CP117606 | ||
| Organism | Escherichia albertii strain BIA_29 | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | L4J948 |
| Locus tag | PS031_RS06115 | Protein ID | WP_000605676.1 |
| Coordinates | 1263861..1264139 (-) | Length | 93 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | - |
| Locus tag | PS031_RS06110 | Protein ID | WP_000781369.1 |
| Coordinates | 1263577..1263861 (-) | Length | 95 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PS031_RS06095 (1261493) | 1261493..1262377 | + | 885 | WP_001240583.1 | formate dehydrogenase N subunit beta | - |
| PS031_RS06100 (1262370) | 1262370..1263023 | + | 654 | WP_000045636.1 | formate dehydrogenase-N subunit gamma | - |
| PS031_RS06105 (1263096) | 1263096..1263572 | + | 477 | WP_059225294.1 | NUDIX domain-containing protein | - |
| PS031_RS06110 (1263577) | 1263577..1263861 | - | 285 | WP_000781369.1 | HigA family addiction module antitoxin | Antitoxin |
| PS031_RS06115 (1263861) | 1263861..1264139 | - | 279 | WP_000605676.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| PS031_RS06120 (1264325) | 1264325..1265335 | - | 1011 | WP_059225293.1 | alcohol dehydrogenase AdhP | - |
| PS031_RS06125 (1265469) | 1265469..1267166 | - | 1698 | WP_059225292.1 | malate dehydrogenase | - |
| PS031_RS06130 (1267323) | 1267323..1267460 | - | 138 | WP_000841563.1 | stationary-phase-induced ribosome-associated protein | - |
| PS031_RS06135 (1267727) | 1267727..1268158 | + | 432 | WP_262931862.1 | peroxiredoxin OsmC | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 93 a.a. Molecular weight: 10521.10 Da Isoelectric Point: 7.3562
>T271648 WP_000605676.1 NZ_CP117606:c1264139-1263861 [Escherichia albertii]
MIMNFRHKGLRDLFLLGKTSGVIPTQVKRLRHRLAVIDAASCLADIDMPGYRLHPLSGDRDGIWAISVSGNWRITFEFVN
GDAYILDYEDYH
MIMNFRHKGLRDLFLLGKTSGVIPTQVKRLRHRLAVIDAASCLADIDMPGYRLHPLSGDRDGIWAISVSGNWRITFEFVN
GDAYILDYEDYH
Download Length: 279 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|