Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type I Classification (family/domain) hok-sok/-
Location 53175..53429 Replicon plasmid pEA36_2
Accession NZ_CP117592
Organism Escherichia albertii strain BIA_36

Toxin (Protein)


Gene name srnB Uniprot ID G9G1E3
Locus tag PS051_RS24560 Protein ID WP_001312851.1
Coordinates 53175..53324 (-) Length 50 a.a.

Antitoxin (RNA)


Gene name srnC
Locus tag -
Coordinates 53368..53429 (+)

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
PS051_RS24530 (48651) 48651..48752 - 102 Protein_51 XRE family transcriptional regulator -
PS051_RS24535 (49073) 49073..50012 + 940 Protein_52 IS110 family transposase -
PS051_RS24540 (51002) 51002..51859 - 858 WP_273782072.1 incFII family plasmid replication initiator RepA -
PS051_RS24545 (51852) 51852..52334 - 483 WP_001523473.1 hypothetical protein -
PS051_RS24550 (52327) 52327..52401 - 75 WP_001442103.1 RepA leader peptide Tap -
PS051_RS24555 (52634) 52634..52891 - 258 WP_273782073.1 replication regulatory protein RepA -
PS051_RS24560 (53175) 53175..53324 - 150 WP_001312851.1 Hok/Gef family protein Toxin
- (53368) 53368..53429 + 62 NuclAT_0 - Antitoxin
- (53368) 53368..53429 + 62 NuclAT_0 - Antitoxin
- (53368) 53368..53429 + 62 NuclAT_0 - Antitoxin
- (53368) 53368..53429 + 62 NuclAT_0 - Antitoxin
PS051_RS24565 (54015) 54015..54227 - 213 WP_233929316.1 hypothetical protein -
PS051_RS24570 (54367) 54367..54927 - 561 WP_233929315.1 fertility inhibition protein FinO -
PS051_RS24575 (54982) 54982..55728 - 747 WP_273782074.1 conjugal transfer pilus acetylase TraX -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Non-Mobilizable plasmid - - 1..89679 89679


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Hok/gef cell toxic protein

(4-45)


Sequences

Toxin        


Download         Length: 50 a.a.        Molecular weight: 5542.67 Da        Isoelectric Point: 8.7678

>T271583 WP_001312851.1 NZ_CP117592:c53324-53175 [Escherichia albertii]
MTKYALIGLLAVCATVLCFSLIFRERLCELNIHRGNTVVQVTLAYEARK

Download         Length: 150 bp

Antitoxin


Download         Length: 62 bp

>AT271583 NZ_CP117592:53368-53429 [Escherichia albertii]
TTAAGGTACTTCATGCAGACCTCACGAGTTAATGGATTAACGAGTGGGGTCTTCGCATTTCT

Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A829C8K5

Antitoxin

Download structure file

References