Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | hok-sok/- |
Location | 1028569..1028813 | Replicon | chromosome |
Accession | NZ_CP117590 | ||
Organism | Escherichia albertii strain BIA_36 |
Toxin (Protein)
Gene name | hokX | Uniprot ID | - |
Locus tag | PS051_RS04890 | Protein ID | WP_273781716.1 |
Coordinates | 1028661..1028813 (+) | Length | 51 a.a. |
Antitoxin (RNA)
Gene name | sokX | ||
Locus tag | - | ||
Coordinates | 1028569..1028616 (-) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PS051_RS04875 | 1024073..1025872 | + | 1800 | WP_059269048.1 | NADPH-dependent assimilatory sulfite reductase flavoprotein subunit | - |
PS051_RS04880 | 1025872..1027584 | + | 1713 | WP_273781715.1 | assimilatory sulfite reductase (NADPH) hemoprotein subunit | - |
PS051_RS04885 | 1027663..1028397 | + | 735 | WP_001125132.1 | phosphoadenosine phosphosulfate reductase | - |
- | 1028569..1028616 | - | 48 | - | - | Antitoxin |
PS051_RS04890 | 1028661..1028813 | + | 153 | WP_273781716.1 | Hok/Gef family protein | Toxin |
PS051_RS04895 | 1029006..1030118 | - | 1113 | WP_095574181.1 | IS4-like element IS421 family transposase | - |
PS051_RS04900 | 1030208..1031176 | + | 969 | WP_273780737.1 | IS5 family transposase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 51 a.a. Molecular weight: 5558.73 Da Isoelectric Point: 6.0936
>T271566 WP_273781716.1 NZ_CP117590:1028661-1028813 [Escherichia albertii]
MLTKYALVAIIVLCCTVLGFTLMVGDSLCELSIRERGMEFQAVLAYESKK
MLTKYALVAIIVLCCTVLGFTLMVGDSLCELSIRERGMEFQAVLAYESKK
Download Length: 153 bp
Antitoxin
Download Length: 48 bp
>AT271566 NZ_CP117590:c1028616-1028569 [Escherichia albertii]
GTTCGAACGTAGGCCTCAGGTTGATAGAAATATCGCCTGGGGCTTTTG
GTTCGAACGTAGGCCTCAGGTTGATAGAAATATCGCCTGGGGCTTTTG
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|