Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type I Classification (family/domain) hok-sok/-
Location 155373..155630 Replicon chromosome
Accession NZ_CP117590
Organism Escherichia albertii strain BIA_36

Toxin (Protein)


Gene name hokA Uniprot ID V0YDF1
Locus tag PS051_RS00700 Protein ID WP_001135738.1
Coordinates 155478..155630 (+) Length 51 a.a.

Antitoxin (RNA)


Gene name sokA
Locus tag -
Coordinates 155373..155421 (-)

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
PS051_RS00680 150602..151597 - 996 WP_273781530.1 acyltransferase -
PS051_RS00685 151771..152070 + 300 WP_000979961.1 YsaB family lipoprotein -
PS051_RS00690 152166..153077 + 912 WP_001168544.1 glycine--tRNA ligase subunit alpha -
PS051_RS00695 153087..155156 + 2070 WP_001291807.1 glycine--tRNA ligase subunit beta -
- 155373..155421 - 49 - - Antitoxin
PS051_RS00700 155478..155630 + 153 WP_001135738.1 type I toxin-antitoxin system toxin HokA Toxin
PS051_RS00705 155607..155678 - 72 WP_212734940.1 hypothetical protein -
PS051_RS00710 155818..156030 - 213 WP_000014594.1 RNA chaperone/antiterminator CspA -
PS051_RS00715 156313..156603 - 291 WP_059221281.1 HTH-type transcriptional regulator -
PS051_RS00720 157026..157736 + 711 WP_002460072.1 DUF3053 domain-containing protein -
PS051_RS00725 157789..158763 - 975 WP_059221283.1 glyoxylate/hydroxypyruvate reductase GhrB -
PS051_RS00730 158867..159526 - 660 WP_000747625.1 OmpA family lipoprotein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Hok/gef cell toxic protein

(5-46)


Sequences

Toxin        


Download         Length: 51 a.a.        Molecular weight: 5912.14 Da        Isoelectric Point: 7.7173

>T271562 WP_001135738.1 NZ_CP117590:155478-155630 [Escherichia albertii]
MPQKYRLLSLIVICFTLLFFTWMIRDSLCELHIKQGSYELAAFLACNLKE

Download         Length: 153 bp

Antitoxin


Download         Length: 49 bp

>AT271562 NZ_CP117590:c155421-155373 [Escherichia albertii]
GCATAGAGGGGCCTCACTTTGATTTATAGTCAGGTGGGGCTTTTCTCTG

Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A7U9LX93

Antitoxin

Download structure file

References