Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type IV Classification (family/domain) yeeV-yfjZ/CbtA-CbeA
Location 1753966..1754647 Replicon chromosome
Accession NZ_CP117583
Organism Escherichia albertii strain BIA_41

Toxin (Protein)


Gene name yeeV Uniprot ID -
Locus tag PS045_RS08515 Protein ID WP_256879418.1
Coordinates 1754324..1754647 (+) Length 108 a.a.

Antitoxin (Protein)


Gene name yfjZ Uniprot ID -
Locus tag PS045_RS08510 Protein ID WP_256879388.1
Coordinates 1753966..1754286 (+) Length 107 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
PS045_RS08475 (1749053) 1749053..1749331 - 279 WP_256879393.1 helix-turn-helix transcriptional regulator -
PS045_RS08480 (1749595) 1749595..1750029 - 435 WP_256921800.1 DUF3987 domain-containing protein -
PS045_RS08485 (1750023) 1750023..1751006 - 984 WP_256921792.1 DUF3987 domain-containing protein -
PS045_RS08490 (1751326) 1751326..1751997 - 672 WP_256879392.1 inovirus Gp2 family protein -
PS045_RS08495 (1752395) 1752395..1753213 + 819 WP_256879391.1 DUF932 domain-containing protein -
PS045_RS08500 (1753246) 1753246..1753719 + 474 WP_256879390.1 DNA repair protein RadC -
PS045_RS08505 (1753727) 1753727..1753948 + 222 WP_256879389.1 DUF987 family protein -
PS045_RS08510 (1753966) 1753966..1754286 + 321 WP_256879388.1 type IV toxin-antitoxin system YeeU family antitoxin Antitoxin
PS045_RS08515 (1754324) 1754324..1754647 + 324 WP_256879418.1 TA system toxin CbtA family protein Toxin
PS045_RS08520 (1754964) 1754964..1755056 + 93 Protein_1672 integrase -
PS045_RS08525 (1755641) 1755641..1755742 + 102 WP_256879387.1 small membrane protein YkgR -
PS045_RS08530 (1755773) 1755773..1756066 - 294 WP_125282434.1 hypothetical protein -
PS045_RS08535 (1756204) 1756204..1756470 + 267 WP_000812362.1 type B 50S ribosomal protein L31 -
PS045_RS08540 (1756467) 1756467..1756607 + 141 WP_000866440.1 type B 50S ribosomal protein L36 -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Genomic island - - 1723656..1760032 36376


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

CbtA toxin of type IV toxin-antitoxin system

(10-106)

Antitoxin

Antitoxin CbeA

(4-102)


Sequences

Toxin        


Download         Length: 108 a.a.        Molecular weight: 12200.96 Da        Isoelectric Point: 6.0691

>T271520 WP_256879418.1 NZ_CP117583:1754324-1754647 [Escherichia albertii]
ILSVPTTVPISSRLSPVQVWQQLLTYLLEHHYGLTLNDTPFHDDAAIEEHIEAGITLADAVNFLVEKYELVRIDRKGFSW
QEQTPYISVVDILRARRSTGLLKTNVK

Download         Length: 324 bp

Antitoxin


Download         Length: 107 a.a.        Molecular weight: 12010.67 Da        Isoelectric Point: 6.7439

>AT271520 WP_256879388.1 NZ_CP117583:1753966-1754286 [Escherichia albertii]
MKNSWGLKRDMTPCFGARLVQEGRRLHFLADRADISGAFNEEEALRLDQAFPPVMKQLELMLTTGELNPRHQHCVTLHHN
GLTCEADTLGSHGYVYIVIYPQTSSQ

Download         Length: 321 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure

References