Detailed information of TA system TA271468

Bioinformatically predicted

Overview

TA module

• Type: I
• Classification (family/domain): hok-sok/-
• Location: 381545..381770
• Replicon: chromosome
• Accession: NZ_CP117575
• Organism: Escherichia albertii strain BIA_5

Toxin (Protein)

• Gene name: hokW
• Uniprot ID: -
• Locus tag: PS037_RS01880
• Protein ID: WP_047624851.1
• Coordinates: 381615..381770 (+)
• Length: 52 a.a.

Antitoxin (RNA)

Gene name	sokW
Locus tag	-
Coordinates	381545..381603 (-)

Genomic Context

Locus tag	Coordinates	Strand	Size (bp)	Protein ID	Product	Description
PS037_RS01830	376713..376943	+	231	WP_273821471.1	Cro/CI family transcriptional regulator	-
PS037_RS01835	376927..377448	+	522	WP_273821472.1	toxin YdaT family protein	-
PS037_RS01840	377429..378394	+	966	WP_273821474.1	hypothetical protein	-
PS037_RS01845	378435..378848	+	414	WP_098401685.1	DUF977 family protein	-
PS037_RS01850	378848..379138	+	291	WP_273821475.1	DUF4752 family protein	-
PS037_RS01855	379135..379632	+	498	WP_273821476.1	hypothetical protein	-
PS037_RS01860	379634..379990	+	357	WP_172953528.1	hypothetical protein	-
PS037_RS01865	380085..380489	+	405	WP_273821477.1	hypothetical protein	-
PS037_RS01870	380491..380700	+	210	WP_122998051.1	hypothetical protein	-
PS037_RS01875	380697..381323	+	627	WP_273821479.1	DUF551 domain-containing protein	-
-	381545..381603	-	59	-	-	Antitoxin
PS037_RS01880	381615..381770	+	156	WP_047624851.1	type I toxin-antitoxin system toxin HokD	Toxin
PS037_RS01885	381990..382253	+	264	WP_105233863.1	hypothetical protein	-
PS037_RS01890	382321..382599	+	279	WP_273821481.1	hypothetical protein	-
PS037_RS01895	382601..383658	+	1058	Protein_374	DUF968 domain-containing protein	-
PS037_RS01900	383659..384036	+	378	WP_273821482.1	RusA family crossover junction endodeoxyribonuclease	-
PS037_RS01905	384026..384412	+	387	WP_059251056.1	antiterminator Q family protein	-
PS037_RS01910	384691..385255	+	565	Protein_377	ORF6N domain-containing protein	-

Associated MGEs

MGE detail	Similar MGEs	Relative position	MGE Type	Cargo ARG	Virulence gene	Coordinates	Length (bp)
	-	inside	Prophage	-	-	364661..412400	47739

Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.

Domains

Predicted by InterproScan

Toxin

• Hok/gef cell toxic protein (6-47)

Sequences

Toxin

Protein

• Length: 52 a.a.
• Molecular weight: 5706.86 Da
• Isoelectric Point: 6.1531

>T271468 WP_047624851.1 NZ_CP117575:381615-381770 [Escherichia albertii]
MKQQKAMLIALIVICLTVIVAALVTRKDLCEVRIRTGQTEVAVFTAYEPEE

Nucleotide

• Length: 156 bp

Antitoxin

Nucleotide

• Length: 59 bp

>AT271468 NZ_CP117575:c381603-381545 [Escherichia albertii]
CCTTGCCTTTCGGCACGTAAGAGGCTAACCTACATGTGTTCAGCATGGATTGAGCCTCA

Structures

Antitoxin