Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | ykfI-yeeU/CbtA-CbeA |
| Location | 4017053..4017760 | Replicon | chromosome |
| Accession | NZ_CP117570 | ||
| Organism | Escherichia albertii strain BIA_50 | ||
Toxin (Protein)
| Gene name | ykfI | Uniprot ID | - |
| Locus tag | PS035_RS19355 | Protein ID | WP_161537416.1 |
| Coordinates | 4017053..4017394 (-) | Length | 114 a.a. |
Antitoxin (Protein)
| Gene name | yeeU | Uniprot ID | A0A3L1KVZ6 |
| Locus tag | PS035_RS19360 | Protein ID | WP_000939437.1 |
| Coordinates | 4017425..4017760 (-) | Length | 112 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PS035_RS19330 (4013336) | 4013336..4014319 | - | 984 | WP_161537412.1 | restriction endonuclease | - |
| PS035_RS19335 (4014591) | 4014591..4015382 | - | 792 | WP_161537413.1 | helix-turn-helix transcriptional regulator | - |
| PS035_RS19340 (4015501) | 4015501..4015776 | - | 276 | WP_161537414.1 | type II toxin-antitoxin system RelE/ParE family toxin | - |
| PS035_RS19345 (4015780) | 4015780..4016028 | - | 249 | WP_024187601.1 | ribbon-helix-helix domain-containing protein | - |
| PS035_RS19350 (4016105) | 4016105..4016938 | - | 834 | WP_161537415.1 | DUF4942 domain-containing protein | - |
| PS035_RS19355 (4017053) | 4017053..4017394 | - | 342 | WP_161537416.1 | TA system toxin CbtA family protein | Toxin |
| PS035_RS19360 (4017425) | 4017425..4017760 | - | 336 | WP_000939437.1 | type IV toxin-antitoxin system YeeU family antitoxin | Antitoxin |
| PS035_RS19365 (4017760) | 4017760..4018233 | - | 474 | WP_161537417.1 | DNA repair protein RadC | - |
| PS035_RS19370 (4018263) | 4018263..4019081 | - | 819 | WP_161537418.1 | DUF932 domain-containing protein | - |
| PS035_RS19375 (4019625) | 4019625..4020269 | - | 645 | WP_237579909.1 | hypothetical protein | - |
| PS035_RS19380 (4020862) | 4020862..4021278 | + | 417 | WP_273817457.1 | inovirus-type Gp2 protein | - |
| PS035_RS19385 (4021354) | 4021354..4022582 | + | 1229 | WP_183042231.1 | IS3-like element IS2 family transposase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Genomic island | - | vat | 4002871..4037419 | 34548 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 114 a.a. Molecular weight: 13049.02 Da Isoelectric Point: 9.5454
>T271463 WP_161537416.1 NZ_CP117570:c4017394-4017053 [Escherichia albertii]
MKIIPATTLRATTSYLSPVVVWQTLLARLLEQHYGLNLNDTPFNNEKVIQEHIDAGITLVDAVNFLVEKYELIRIDRKGF
SWQEQTPYLRAVDILRARQATGQLRRCHNTTAR
MKIIPATTLRATTSYLSPVVVWQTLLARLLEQHYGLNLNDTPFNNEKVIQEHIDAGITLVDAVNFLVEKYELIRIDRKGF
SWQEQTPYLRAVDILRARQATGQLRRCHNTTAR
Download Length: 342 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|