Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | cptAB/Cpta(toxin) |
| Location | 906674..907325 | Replicon | chromosome |
| Accession | NZ_CP117570 | ||
| Organism | Escherichia albertii strain BIA_50 | ||
Toxin (Protein)
| Gene name | cptA | Uniprot ID | B1EG01 |
| Locus tag | PS035_RS04400 | Protein ID | WP_000244763.1 |
| Coordinates | 906921..907325 (+) | Length | 135 a.a. |
Antitoxin (Protein)
| Gene name | cptB | Uniprot ID | S1PPB1 |
| Locus tag | PS035_RS04395 | Protein ID | WP_000354046.1 |
| Coordinates | 906674..906940 (+) | Length | 89 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PS035_RS04370 (902386) | 902386..903819 | - | 1434 | WP_024164724.1 | 6-phospho-beta-glucosidase BglA | - |
| PS035_RS04375 (903864) | 903864..904175 | + | 312 | WP_273817723.1 | N(4)-acetylcytidine aminohydrolase | - |
| PS035_RS04380 (904343) | 904343..905002 | + | 660 | WP_000250281.1 | hemolysin III family protein | - |
| PS035_RS04385 (905442) | 905442..906422 | - | 981 | WP_273817724.1 | tRNA-modifying protein YgfZ | - |
| PS035_RS04390 (906454) | 906454..906684 | + | 231 | WP_000181267.1 | hypothetical protein | - |
| PS035_RS04395 (906674) | 906674..906940 | + | 267 | WP_000354046.1 | FAD assembly factor SdhE | Antitoxin |
| PS035_RS04400 (906921) | 906921..907325 | + | 405 | WP_000244763.1 | protein YgfX | Toxin |
| PS035_RS04405 (907364) | 907364..907885 | - | 522 | WP_125060507.1 | flavodoxin FldB | - |
| PS035_RS04410 (907997) | 907997..908893 | + | 897 | WP_000806638.1 | site-specific tyrosine recombinase XerD | - |
| PS035_RS04415 (908918) | 908918..909628 | + | 711 | WP_000748105.1 | bifunctional protein-disulfide isomerase/oxidoreductase DsbC | - |
| PS035_RS04420 (909634) | 909634..911367 | + | 1734 | WP_273817726.1 | single-stranded-DNA-specific exonuclease RecJ | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 135 a.a. Molecular weight: 15888.81 Da Isoelectric Point: 11.1732
>T271449 WP_000244763.1 NZ_CP117570:906921-907325 [Escherichia albertii]
VVLWQSDLRVSWRAQWLSLLIHGLVAAAILLMPWPLSYTPLWMVLLSLVVFDCVRSQRRINARQGEIRLLMDGRLRWQGQ
EWSIVRAPWMIKTGMMLRLLSDSGKRQHLWLAADSMDEAEWRDLRRILLQQEIQ
VVLWQSDLRVSWRAQWLSLLIHGLVAAAILLMPWPLSYTPLWMVLLSLVVFDCVRSQRRINARQGEIRLLMDGRLRWQGQ
EWSIVRAPWMIKTGMMLRLLSDSGKRQHLWLAADSMDEAEWRDLRRILLQQEIQ
Download Length: 405 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A2S6P9B3 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| PDB | 6B58 | |
| PDB | 1X6I | |
| PDB | 1X6J | |
| PDB | 6C12 | |
| AlphaFold DB | A0A7U9QD57 |