Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type I Classification (family/domain) hok-sok/-
Location 162339..162596 Replicon chromosome
Accession NZ_CP117570
Organism Escherichia albertii strain BIA_50

Toxin (Protein)


Gene name hokA Uniprot ID V0YDF1
Locus tag PS035_RS00730 Protein ID WP_001135738.1
Coordinates 162444..162596 (+) Length 51 a.a.

Antitoxin (RNA)


Gene name sokA
Locus tag -
Coordinates 162339..162393 (-)

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
PS035_RS00710 157570..158565 - 996 WP_273817581.1 acyltransferase -
PS035_RS00715 158738..159037 + 300 WP_000979961.1 YsaB family lipoprotein -
PS035_RS00720 159133..160044 + 912 WP_001168544.1 glycine--tRNA ligase subunit alpha -
PS035_RS00725 160054..162123 + 2070 WP_001291807.1 glycine--tRNA ligase subunit beta -
- 162339..162393 - 55 - - Antitoxin
PS035_RS00730 162444..162596 + 153 WP_001135738.1 type I toxin-antitoxin system toxin HokA Toxin
PS035_RS00735 162748..163434 + 687 WP_059271833.1 hypothetical protein -
PS035_RS00740 163502..163714 - 213 WP_000014594.1 RNA chaperone/antiterminator CspA -
PS035_RS00745 163997..164287 - 291 WP_000455794.1 HTH-type transcriptional regulator -
PS035_RS00750 164710..165420 + 711 WP_002460072.1 DUF3053 domain-containing protein -
PS035_RS00755 165473..166447 - 975 WP_000804993.1 glyoxylate/hydroxypyruvate reductase GhrB -
PS035_RS00760 166551..167210 - 660 WP_000747625.1 OmpA family lipoprotein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Hok/gef cell toxic protein

(5-46)


Sequences

Toxin        


Download         Length: 51 a.a.        Molecular weight: 5912.14 Da        Isoelectric Point: 7.7173

>T271447 WP_001135738.1 NZ_CP117570:162444-162596 [Escherichia albertii]
MPQKYRLLSLIVICFTLLFFTWMIRDSLCELHIKQGSYELAAFLACNLKE

Download         Length: 153 bp

Antitoxin


Download         Length: 55 bp

>AT271447 NZ_CP117570:c162393-162339 [Escherichia albertii]
GTTCAGGCATAGGGTAGCCTCACTTTGATTTATAGTCAGGTGGGGCTTTTCTCTG

Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A7U9LX93

Antitoxin

Download structure file

References