Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | phd-doc/Doc-RelB |
| Location | 3732095..3732699 | Replicon | chromosome |
| Accession | NZ_CP117562 | ||
| Organism | Escherichia albertii strain BIA_7 | ||
Toxin (Protein)
| Gene name | doc | Uniprot ID | - |
| Locus tag | PS049_RS18455 | Protein ID | WP_273819852.1 |
| Coordinates | 3732313..3732699 (+) | Length | 129 a.a. |
Antitoxin (Protein)
| Gene name | phd | Uniprot ID | B1ELZ9 |
| Locus tag | PS049_RS18450 | Protein ID | WP_001195490.1 |
| Coordinates | 3732095..3732316 (+) | Length | 74 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PS049_RS18435 (3728345) | 3728345..3729796 | + | 1452 | WP_059238165.1 | tagaturonate reductase | - |
| PS049_RS18440 (3730001) | 3730001..3730915 | + | 915 | WP_273820346.1 | bestrophin family protein | - |
| PS049_RS18445 (3730919) | 3730919..3731677 | - | 759 | WP_044709411.1 | trans-aconitate 2-methyltransferase | - |
| PS049_RS18450 (3732095) | 3732095..3732316 | + | 222 | WP_001195490.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | Antitoxin |
| PS049_RS18455 (3732313) | 3732313..3732699 | + | 387 | WP_273819852.1 | type II toxin-antitoxin system death-on-curing family toxin | Toxin |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 129 a.a. Molecular weight: 14461.48 Da Isoelectric Point: 9.0256
>T271408 WP_273819852.1 NZ_CP117562:3732313-3732699 [Escherichia albertii]
MIWVSAQEVIAFHARILQRFPGVAGLTDPGRAQALIYRVQNRVHYEGVTDLFELAATYWVAIARGHIFHDGNKRTAFFVT
MTFLWRNGIRIRDVDNSLENLTVEAATGEKTVGQLARCLRERVDSSGN
MIWVSAQEVIAFHARILQRFPGVAGLTDPGRAQALIYRVQNRVHYEGVTDLFELAATYWVAIARGHIFHDGNKRTAFFVT
MTFLWRNGIRIRDVDNSLENLTVEAATGEKTVGQLARCLRERVDSSGN
Download Length: 387 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|