Detailed information of TA system TA271358

Bioinformatically predicted

Overview

TA module

• Type: I
• Classification (family/domain): hok-sok/-
• Location: 35780..36206
• Replicon: plasmid pEA89-5_1
• Accession: NZ_CP117557
• Organism: Escherichia albertii strain BIA_89-5

Toxin (Protein)

• Gene name: hok
• Uniprot ID: -
• Locus tag: PS032_RS25855
• Protein ID: WP_001372321.1
• Coordinates: 36081..36206 (+)
• Length: 42 a.a.

Antitoxin (RNA)

Gene name	sok
Locus tag	-
Coordinates	35780..36004 (+)

Genomic Context

Locus tag	Coordinates	Strand	Size (bp)	Protein ID	Product	Description
PS032_RS25810 (30975)	30975..31398	-	424	Protein_36	hypothetical protein	-
PS032_RS25815 (31468)	31468..31674	+	207	WP_000547944.1	hypothetical protein	-
PS032_RS25820 (31700)	31700..32236	+	537	WP_000290806.1	single-stranded DNA-binding protein	-
PS032_RS25825 (32294)	32294..32527	+	234	WP_053272376.1	DUF905 domain-containing protein	-
PS032_RS25830 (32591)	32591..34549	+	1959	WP_137650591.1	ParB/RepB/Spo0J family partition protein	-
PS032_RS25835 (34618)	34618..35052	+	435	WP_089572216.1	conjugation system SOS inhibitor PsiB	-
PS032_RS25840 (35049)	35049..35811	+	763	Protein_42	plasmid SOS inhibition protein A	-
PS032_RS25845 (35780)	35780..35968	-	189	WP_157904642.1	protein sok	-
- (35780)	35780..36004	+	225	NuclAT_0	-	Antitoxin
- (35780)	35780..36004	+	225	NuclAT_0	-	Antitoxin
- (35780)	35780..36004	+	225	NuclAT_0	-	Antitoxin
- (35780)	35780..36004	+	225	NuclAT_0	-	Antitoxin
PS032_RS25850 (35990)	35990..36139	+	150	Protein_44	plasmid maintenance protein Mok	-
PS032_RS25855 (36081)	36081..36206	+	126	WP_001372321.1	type I toxin-antitoxin system Hok family toxin	Toxin
PS032_RS25860 (36427)	36427..36657	+	231	WP_001426396.1	hypothetical protein	-
PS032_RS25865 (36655)	36655..36827	-	173	Protein_47	hypothetical protein	-
PS032_RS25870 (36897)	36897..37103	+	207	WP_089644688.1	single-stranded DNA-binding protein	-
PS032_RS25875 (37127)	37127..37423	+	297	WP_273807102.1	hypothetical protein	-
PS032_RS25880 (37678)	37678..38112	+	435	WP_122989639.1	transposase	-
PS032_RS25885 (38109)	38109..38459	+	351	WP_089572268.1	IS66 family insertion sequence element accessory protein TnpB	-
PS032_RS25890 (38490)	38490..40082	+	1593	WP_137650637.1	IS66 family transposase	-
PS032_RS25895 (40075)	40075..41039	+	965	Protein_53	plasmid segregation protein ParM	-

Associated MGEs

MGE detail	Similar MGEs	Relative position	MGE Type	Cargo ARG	Virulence gene	Coordinates	Length (bp)
	-	inside	Non-Mobilizable plasmid	-	-	1..75610	75610

Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.

Domains

Predicted by InterproScan

Toxin

• Hok/gef cell toxic protein (2-37)

Sequences

Toxin

Protein

• Length: 42 a.a.
• Molecular weight: 4780.69 Da
• Isoelectric Point: 8.5110

>T271358 WP_001372321.1 NZ_CP117557:36081-36206 [Escherichia albertii]
VLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK

Nucleotide

• Length: 126 bp

Antitoxin

Nucleotide

• Length: 225 bp

>AT271358 NZ_CP117557:35780-36004 [Escherichia albertii]
TCACACGGATTGCCCGTGAACGGTCTGAATGAGCGGATTATTTTCAGGGAAAGTGAGTGTGGTCAGCGTGCAGGTATATG
GGCTATGATGTGCCCGGCGCTTGAGGCTTTCTGCCTCATGACGTGAAGGTGGTTTGTTGCCGTGTTGTGTGGCAGAAAGA
AGATAGCCCCGTAGTAAGTTAATTTTCATTAACCACCACGAGGCATCCCTATGTCTAGTCCACAT

Structures

Antitoxin