Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | symE-sib/SymE(toxin) |
| Location | 4355488..4355900 | Replicon | chromosome |
| Accession | NZ_CP117556 | ||
| Organism | Escherichia albertii strain BIA_89-5 | ||
Toxin (Protein)
| Gene name | symE | Uniprot ID | A0A8D9PK47 |
| Locus tag | PS032_RS21880 | Protein ID | WP_000132619.1 |
| Coordinates | 4355559..4355900 (+) | Length | 114 a.a. |
Antitoxin (RNA)
| Gene name | sib | ||
| Locus tag | - | ||
| Coordinates | 4355488..4355564 (-) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PS032_RS21870 (4352360) | 4352360..4353949 | + | 1590 | WP_074463834.1 | type I restriction-modification system methyltransferase | - |
| PS032_RS21875 (4353946) | 4353946..4355331 | + | 1386 | WP_059257978.1 | restriction endonuclease subunit S | - |
| - (4355488) | 4355488..4355564 | - | 77 | NuclAT_8 | - | Antitoxin |
| - (4355488) | 4355488..4355564 | - | 77 | NuclAT_8 | - | Antitoxin |
| - (4355488) | 4355488..4355564 | - | 77 | NuclAT_8 | - | Antitoxin |
| - (4355488) | 4355488..4355564 | - | 77 | NuclAT_8 | - | Antitoxin |
| - (4355488) | 4355488..4355564 | - | 77 | NuclAT_9 | - | Antitoxin |
| - (4355488) | 4355488..4355564 | - | 77 | NuclAT_9 | - | Antitoxin |
| - (4355488) | 4355488..4355564 | - | 77 | NuclAT_9 | - | Antitoxin |
| - (4355488) | 4355488..4355564 | - | 77 | NuclAT_9 | - | Antitoxin |
| PS032_RS21880 (4355559) | 4355559..4355900 | + | 342 | WP_000132619.1 | endoribonuclease SymE | Toxin |
| PS032_RS21885 (4356062) | 4356062..4357441 | + | 1380 | WP_059217670.1 | 5-methylcytosine-specific restriction endonuclease subunit McrB | - |
| PS032_RS21890 (4357441) | 4357441..4358487 | + | 1047 | WP_074463833.1 | 5-methylcytosine-specific restriction endonuclease system specificity protein McrC | - |
| PS032_RS21895 (4358543) | 4358543..4359621 | - | 1079 | Protein_4280 | DUF1998 domain-containing protein | - |
| PS032_RS21900 (4359936) | 4359936..4360868 | - | 933 | Protein_4281 | Rpn family recombination-promoting nuclease/putative transposase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 114 a.a. Molecular weight: 12322.13 Da Isoelectric Point: 7.8219
>T271352 WP_000132619.1 NZ_CP117556:4355559-4355900 [Escherichia albertii]
MTDTHSIAQPFEAEVSPANNRQLTVSYASRYPDYSRIPAITLKGQWLEAAGFATGTAVDVKVMEGCIVLTAQPPAPEESE
LMQSLRQVCKLSARKQKQVQEFIGVIAGKQKVA
MTDTHSIAQPFEAEVSPANNRQLTVSYASRYPDYSRIPAITLKGQWLEAAGFATGTAVDVKVMEGCIVLTAQPPAPEESE
LMQSLRQVCKLSARKQKQVQEFIGVIAGKQKVA
Download Length: 342 bp
Antitoxin
Download Length: 77 bp
>AT271352 NZ_CP117556:c4355564-4355488 [Escherichia albertii]
AGTCATAACTGCTATTCTCCGATAATAGTGATTGTGATGAGCGGTGCGGGTGTGTTGGCGCACATCCGCACCGCGCT
AGTCATAACTGCTATTCTCCGATAATAGTGATTGTGATGAGCGGTGCGGGTGTGTTGGCGCACATCCGCACCGCGCT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|