Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/HigB-HigA |
| Location | 661554..662281 | Replicon | chromosome |
| Accession | NZ_CP117556 | ||
| Organism | Escherichia albertii strain BIA_89-5 | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | U9ZMR4 |
| Locus tag | PS032_RS03360 | Protein ID | WP_000550189.1 |
| Coordinates | 661554..661868 (+) | Length | 105 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | - |
| Locus tag | PS032_RS03365 | Protein ID | WP_000560272.1 |
| Coordinates | 661865..662281 (+) | Length | 139 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PS032_RS03340 (657713) | 657713..658699 | - | 987 | WP_059216461.1 | Gfo/Idh/MocA family oxidoreductase | - |
| PS032_RS03345 (658778) | 658778..659470 | - | 693 | WP_059216460.1 | vancomycin high temperature exclusion protein | - |
| PS032_RS03350 (659547) | 659547..660050 | - | 504 | WP_059216459.1 | M48 family metallopeptidase | - |
| PS032_RS03355 (660135) | 660135..661271 | + | 1137 | WP_000018669.1 | 23S rRNA (guanine(1835)-N(2))-methyltransferase RlmG | - |
| PS032_RS03360 (661554) | 661554..661868 | + | 315 | WP_000550189.1 | type II toxin-antitoxin system toxin HigB | Toxin |
| PS032_RS03365 (661865) | 661865..662281 | + | 417 | WP_000560272.1 | type II toxin-antitoxin system antitoxin HigA | Antitoxin |
| PS032_RS03370 (662371) | 662371..664388 | - | 2018 | Protein_659 | NADPH-dependent 2,4-dienoyl-CoA reductase | - |
| PS032_RS03375 (664615) | 664615..666966 | - | 2352 | WP_137653395.1 | alpha-glucosidase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 105 a.a. Molecular weight: 12103.10 Da Isoelectric Point: 10.0409
>T271334 WP_000550189.1 NZ_CP117556:661554-661868 [Escherichia albertii]
MHLITQKALKDAAEKYPQHKTELVALGNTIAKGYFKKPESLKAVFPSLDNFKYLDKHYVFNVGGNELRVVAMVFFESQKC
YIREVMTHKEYDFFTAVHRTKGKK
MHLITQKALKDAAEKYPQHKTELVALGNTIAKGYFKKPESLKAVFPSLDNFKYLDKHYVFNVGGNELRVVAMVFFESQKC
YIREVMTHKEYDFFTAVHRTKGKK
Download Length: 315 bp
Antitoxin
Download Length: 139 a.a. Molecular weight: 14993.40 Da Isoelectric Point: 4.3697
>AT271334 WP_000560272.1 NZ_CP117556:661865-662281 [Escherichia albertii]
MIAIADILQAGEKLTDVAPFLAGIQSEEQYAQALELVDHLLLNDPENPLLDLVCAKITAWEESAPEFAEFNAMVQAMPGG
VAVIRTLMDQYGLTLSDLPEIGSKSMVSRVLNGKRKLTLEHAKKLAARFGISPALFID
MIAIADILQAGEKLTDVAPFLAGIQSEEQYAQALELVDHLLLNDPENPLLDLVCAKITAWEESAPEFAEFNAMVQAMPGG
VAVIRTLMDQYGLTLSDLPEIGSKSMVSRVLNGKRKLTLEHAKKLAARFGISPALFID
Download Length: 417 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|