Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type I Classification (family/domain) hok-sok/-
Location 388014..388239 Replicon chromosome
Accession NZ_CP117556
Organism Escherichia albertii strain BIA_89-5

Toxin (Protein)


Gene name hokW Uniprot ID A0A7L6L988
Locus tag PS032_RS01830 Protein ID WP_000813269.1
Coordinates 388084..388239 (+) Length 52 a.a.

Antitoxin (RNA)


Gene name sokW
Locus tag -
Coordinates 388014..388072 (-)

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
PS032_RS01805 383879..385105 + 1227 WP_137650399.1 phosphopentomutase -
PS032_RS01810 385144..385879 - 736 Protein_357 transposase -
PS032_RS01815 385971..386039 + 69 Protein_358 hypothetical protein -
PS032_RS01820 386173..386727 - 555 WP_024229929.1 hypothetical protein -
PS032_RS01825 386724..387656 - 933 WP_059259885.1 hypothetical protein -
- 388014..388072 - 59 - - Antitoxin
PS032_RS01830 388084..388239 + 156 WP_000813269.1 type I toxin-antitoxin system toxin HokD Toxin
PS032_RS01835 388492..388569 + 78 Protein_362 hypothetical protein -
PS032_RS01840 388725..389324 + 600 WP_059259884.1 DUF1367 family protein -
PS032_RS01845 389324..389614 + 291 WP_059259883.1 DUF1364 domain-containing protein -
PS032_RS01850 389611..390153 + 543 WP_059259882.1 DUF1133 family protein -
PS032_RS01855 390651..390986 + 336 WP_001766841.1 phage holin, lambda family -
PS032_RS01860 390990..391466 + 477 WP_001194114.1 glycoside hydrolase family protein -
PS032_RS01865 391450..391842 + 393 WP_059214839.1 DUF2570 domain-containing protein -
PS032_RS01870 391727..392005 + 279 WP_233991579.1 hypothetical protein -
PS032_RS01875 392050..392172 + 123 WP_262409882.1 hypothetical protein -
PS032_RS01880 392291..392548 + 258 Protein_371 ParB/Srx family N-terminal domain-containing protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Prophage - - 385144..434158 49014
- inside Prophage - - 372997..434158 61161


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Hok/gef cell toxic protein

(6-47)


Sequences

Toxin        


Download         Length: 52 a.a.        Molecular weight: 5722.86 Da        Isoelectric Point: 6.1531

>T271332 WP_000813269.1 NZ_CP117556:388084-388239 [Escherichia albertii]
MKQQKAMLVALIVICLTVIVTALVTRKDLCEVRIRTGQTEVAVFTAYEPEE

Download         Length: 156 bp

Antitoxin


Download         Length: 59 bp

>AT271332 NZ_CP117556:c388072-388014 [Escherichia albertii]
CCTTGCCTTTCGGCACGTAAGAGGCTAACCTACATGTGTTCAGCATGGATTGAGCCTCA

Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A7L6L988

Antitoxin

Download structure file

References