Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | Hha-TomB/- |
| Location | 1084037..1084664 | Replicon | chromosome |
| Accession | NZ_CP117554 | ||
| Organism | Erwinia amylovora strain 99east-3-1 | ||
Toxin (Protein)
| Gene name | Hha | Uniprot ID | D2T444 |
| Locus tag | PTC76_RS04995 | Protein ID | WP_004156337.1 |
| Coordinates | 1084037..1084255 (-) | Length | 73 a.a. |
Antitoxin (Protein)
| Gene name | TomB | Uniprot ID | - |
| Locus tag | PTC76_RS05000 | Protein ID | WP_013035913.1 |
| Coordinates | 1084275..1084664 (-) | Length | 130 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PTC76_RS04965 (PTC76_04965) | 1080023..1080361 | + | 339 | WP_004156319.1 | P-II family nitrogen regulator | - |
| PTC76_RS04970 (PTC76_04970) | 1080379..1081680 | + | 1302 | WP_004172214.1 | ammonium transporter AmtB | - |
| PTC76_RS04975 (PTC76_04975) | 1081755..1082615 | - | 861 | WP_004156324.1 | acyl-CoA thioesterase II | - |
| PTC76_RS04980 (PTC76_04980) | 1082840..1083397 | + | 558 | WP_004156333.1 | YbaY family lipoprotein | - |
| PTC76_RS04985 (PTC76_04985) | 1083420..1083737 | - | 318 | WP_168397246.1 | MGMT family protein | - |
| PTC76_RS04995 (PTC76_04995) | 1084037..1084255 | - | 219 | WP_004156337.1 | HHA domain-containing protein | Toxin |
| PTC76_RS05000 (PTC76_05000) | 1084275..1084664 | - | 390 | WP_013035913.1 | Hha toxicity modulator TomB | Antitoxin |
| PTC76_RS05005 (PTC76_05005) | 1084811..1085164 | - | 354 | WP_004156342.1 | hypothetical protein | - |
| PTC76_RS05010 (PTC76_05010) | 1085936..1086082 | - | 147 | WP_004156349.1 | type B 50S ribosomal protein L36 | - |
| PTC76_RS05015 (PTC76_05015) | 1086070..1086351 | - | 282 | WP_004156350.1 | type B 50S ribosomal protein L31 | - |
| PTC76_RS05020 (PTC76_05020) | 1086499..1089645 | - | 3147 | WP_004156353.1 | multidrug efflux RND transporter permease subunit AcrB | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 73 a.a. Molecular weight: 8627.06 Da Isoelectric Point: 8.9007
>T271324 WP_004156337.1 NZ_CP117554:c1084255-1084037 [Erwinia amylovora]
MTDKLLTKTDYLMRLRRCRSIDTLERVIEKNKYELSDDELAVFYSAADHRLAELTMNKLYDKVPVAVWKFVR
MTDKLLTKTDYLMRLRRCRSIDTLERVIEKNKYELSDDELAVFYSAADHRLAELTMNKLYDKVPVAVWKFVR
Download Length: 219 bp
Antitoxin
Download Length: 130 a.a. Molecular weight: 14965.70 Da Isoelectric Point: 4.7040
>AT271324 WP_013035913.1 NZ_CP117554:c1084664-1084275 [Erwinia amylovora]
MDEYSPKRHDIAQLKFLCENLYDESLATLGDSHHGWVNDPTSTSNLQLNDLIEHIAAFTMNYKIKHIEDSDLISQIDEYL
DDTFMLFSNYGVNNLDLQRWQKSAKRLFNIFAKECVMSQIQSSHSFSSP
MDEYSPKRHDIAQLKFLCENLYDESLATLGDSHHGWVNDPTSTSNLQLNDLIEHIAAFTMNYKIKHIEDSDLISQIDEYL
DDTFMLFSNYGVNNLDLQRWQKSAKRLFNIFAKECVMSQIQSSHSFSSP
Download Length: 390 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|