Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/COG4683-HTH_37 |
| Location | 13609..14266 | Replicon | plasmid pRM038_1 |
| Accession | NZ_CP117379 | ||
| Organism | Salmonella enterica subsp. enterica serovar Newport strain RM038 | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | U3PDC3 |
| Locus tag | PQP81_RS23730 | Protein ID | WP_000270043.1 |
| Coordinates | 13916..14266 (-) | Length | 117 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | - |
| Locus tag | PQP81_RS23725 | Protein ID | WP_000124640.1 |
| Coordinates | 13609..13911 (-) | Length | 101 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PQP81_RS23680 (PQP81_23680) | 9234..9662 | + | 429 | WP_000591074.1 | hypothetical protein | - |
| PQP81_RS23685 (PQP81_23685) | 9719..10078 | + | 360 | WP_000422768.1 | hypothetical protein | - |
| PQP81_RS23690 (PQP81_23690) | 10078..10524 | + | 447 | WP_000919345.1 | Fe3+-siderophore ABC transporter permease | - |
| PQP81_RS23695 (PQP81_23695) | 10521..11039 | + | 519 | WP_000210756.1 | nitrite reductase | - |
| PQP81_RS23700 (PQP81_23700) | 11039..11269 | + | 231 | WP_000972663.1 | hypothetical protein | - |
| PQP81_RS23705 (PQP81_23705) | 11256..12113 | + | 858 | WP_001167032.1 | hypothetical protein | - |
| PQP81_RS23710 (PQP81_23710) | 12344..12871 | + | 528 | WP_001236377.1 | thermonuclease family protein | - |
| PQP81_RS23715 (PQP81_23715) | 12929..13201 | + | 273 | WP_001043047.1 | HU family DNA-binding protein | - |
| PQP81_RS23720 (PQP81_23720) | 13289..13582 | + | 294 | WP_001239997.1 | chromosome segregation protein ParM | - |
| PQP81_RS23725 (PQP81_23725) | 13609..13911 | - | 303 | WP_000124640.1 | XRE family transcriptional regulator | Antitoxin |
| PQP81_RS23730 (PQP81_23730) | 13916..14266 | - | 351 | WP_000270043.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| PQP81_RS23735 (PQP81_23735) | 14429..14977 | + | 549 | WP_001061574.1 | transcriptional regulator | - |
| PQP81_RS23740 (PQP81_23740) | 15318..15512 | + | 195 | WP_000343597.1 | hypothetical protein | - |
| PQP81_RS23745 (PQP81_23745) | 15523..15894 | + | 372 | WP_000516916.1 | hypothetical protein | - |
| PQP81_RS23750 (PQP81_23750) | 15887..16357 | + | 471 | WP_001281821.1 | hypothetical protein | - |
| PQP81_RS23755 (PQP81_23755) | 16372..16707 | - | 336 | WP_000683476.1 | hypothetical protein | - |
| PQP81_RS23760 (PQP81_23760) | 16804..17292 | + | 489 | WP_001273096.1 | DUF1643 domain-containing protein | - |
| PQP81_RS23765 (PQP81_23765) | 17295..17792 | + | 498 | WP_000062185.1 | hypothetical protein | - |
| PQP81_RS23770 (PQP81_23770) | 18007..18711 | - | 705 | WP_001067855.1 | IS6-like element IS26 family transposase | - |
| PQP81_RS23775 (PQP81_23775) | 18776..18955 | - | 180 | Protein_31 | helix-turn-helix domain-containing protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Conjugative plasmid | floR / tet(A) / aph(6)-Id / aph(3'')-Ib / sul2 / blaCMY-2 | - | 1..99205 | 99205 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 117 a.a. Molecular weight: 13328.21 Da Isoelectric Point: 5.2421
>T270954 WP_000270043.1 NZ_CP117379:c14266-13916 [Salmonella enterica subsp. enterica serovar Newport]
MWVIETTDTFDEWFDALDDTDRANVLASMMVLRDRGPMLSRPYADTVNGSSYSNMKELRVQSKGDPIRAFFAFDPKRKGI
LLCAGNKTGDEKRFYEVMIPIADREFAAHLDKLKKE
MWVIETTDTFDEWFDALDDTDRANVLASMMVLRDRGPMLSRPYADTVNGSSYSNMKELRVQSKGDPIRAFFAFDPKRKGI
LLCAGNKTGDEKRFYEVMIPIADREFAAHLDKLKKE
Download Length: 351 bp
Antitoxin
Download Length: 101 a.a. Molecular weight: 11006.73 Da Isoelectric Point: 7.2036
>AT270954 WP_000124640.1 NZ_CP117379:c13911-13609 [Salmonella enterica subsp. enterica serovar Newport]
MARTLDQMLATEKPEVVAKAQKAATEMLLNIHLAELRDRMNLTQGEIAASLGVRQPTVSEMEKPGRDLKLSSIKRYVEAS
GGKLRLDVELPDGTHYGFAV
MARTLDQMLATEKPEVVAKAQKAATEMLLNIHLAELRDRMNLTQGEIAASLGVRQPTVSEMEKPGRDLKLSSIKRYVEAS
GGKLRLDVELPDGTHYGFAV
Download Length: 303 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|