Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/HigB-HigA |
| Location | 4646196..4646950 | Replicon | chromosome |
| Accession | NZ_CP117378 | ||
| Organism | Salmonella enterica subsp. enterica serovar Newport strain RM038 | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | B5F003 |
| Locus tag | PQP81_RS22705 | Protein ID | WP_000558166.1 |
| Coordinates | 4646196..4646507 (+) | Length | 104 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | - |
| Locus tag | PQP81_RS22710 | Protein ID | WP_001259011.1 |
| Coordinates | 4646504..4646950 (+) | Length | 149 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PQP81_RS22675 (4641854) | 4641854..4642756 | + | 903 | WP_000331364.1 | formate dehydrogenase subunit beta | - |
| PQP81_RS22680 (4642753) | 4642753..4643388 | + | 636 | WP_000829025.1 | formate dehydrogenase cytochrome b556 subunit | - |
| PQP81_RS22685 (4643385) | 4643385..4644314 | + | 930 | WP_000027730.1 | formate dehydrogenase accessory protein FdhE | - |
| PQP81_RS22690 (4644361) | 4644361..4644651 | - | 291 | WP_000362050.1 | DNA-binding transcriptional regulator | - |
| PQP81_RS22695 (4644652) | 4644652..4644963 | - | 312 | WP_001159630.1 | cytotoxic translational repressor of toxin-antitoxin stability system | - |
| PQP81_RS22700 (4645181) | 4645181..4646110 | + | 930 | WP_001127704.1 | alpha/beta hydrolase | - |
| PQP81_RS22705 (4646196) | 4646196..4646507 | + | 312 | WP_000558166.1 | type II toxin-antitoxin system HigB family toxin | Toxin |
| PQP81_RS22710 (4646504) | 4646504..4646950 | + | 447 | WP_001259011.1 | type II toxin-antitoxin system HigA family antitoxin | Antitoxin |
| PQP81_RS22715 (4646965) | 4646965..4647906 | - | 942 | WP_001518251.1 | fatty acid biosynthesis protein FabY | - |
| PQP81_RS22720 (4647951) | 4647951..4648388 | - | 438 | WP_000560969.1 | D-aminoacyl-tRNA deacylase | - |
| PQP81_RS22725 (4648385) | 4648385..4649257 | - | 873 | WP_000921423.1 | virulence factor BrkB family protein | - |
| PQP81_RS22730 (4649251) | 4649251..4649850 | - | 600 | WP_000965695.1 | glucose-1-phosphatase | - |
| PQP81_RS22735 (4650041) | 4650041..4650844 | - | 804 | WP_000059693.1 | DeoR/GlpR family DNA-binding transcription regulator | - |
| PQP81_RS22740 (4650878) | 4650878..4651774 | - | 897 | WP_001520529.1 | sugar kinase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 104 a.a. Molecular weight: 12432.40 Da Isoelectric Point: 9.5334
>T270953 WP_000558166.1 NZ_CP117378:4646196-4646507 [Salmonella enterica subsp. enterica serovar Newport]
VHVISRKPFNEAMLMYPNHELALTELLNVLEKKTFTQPEEMKRYIPSLDNFKYRDKWWVIDVSGNSLRLISYIDFRLHKI
FVKHIVSHAEYDKLTAYYRGNKE
VHVISRKPFNEAMLMYPNHELALTELLNVLEKKTFTQPEEMKRYIPSLDNFKYRDKWWVIDVSGNSLRLISYIDFRLHKI
FVKHIVSHAEYDKLTAYYRGNKE
Download Length: 312 bp
Antitoxin
Download Length: 149 a.a. Molecular weight: 16734.08 Da Isoelectric Point: 6.6451
>AT270953 WP_001259011.1 NZ_CP117378:4646504-4646950 [Salmonella enterica subsp. enterica serovar Newport]
MRTHRQMDATSAKKIVDTFSDAVKTVPLMGEDRNDNEYRRALALVEFLVDHDDLENPLFELLCARISEYEKHAPEFKALN
QHLEKTPPGVSVLRTLMDQYGLKAADLANELGSKSNVSNILNGRRALTVNHIKALTQRFKLPADAFIE
MRTHRQMDATSAKKIVDTFSDAVKTVPLMGEDRNDNEYRRALALVEFLVDHDDLENPLFELLCARISEYEKHAPEFKALN
QHLEKTPPGVSVLRTLMDQYGLKAADLANELGSKSNVSNILNGRRALTVNHIKALTQRFKLPADAFIE
Download Length: 447 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|