Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) tacAT/DUF1778(antitoxin)
Location 4293102..4293883 Replicon chromosome
Accession NZ_CP117378
Organism Salmonella enterica subsp. enterica serovar Newport strain RM038

Toxin (Protein)


Gene name TacT2 Uniprot ID A0A0R9NZI3
Locus tag PQP81_RS21050 Protein ID WP_000625912.1
Coordinates 4293102..4293593 (-) Length 164 a.a.

Antitoxin (Protein)


Gene name TacA2 Uniprot ID M7RNV8
Locus tag PQP81_RS21055 Protein ID WP_001110450.1
Coordinates 4293590..4293883 (-) Length 98 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
PQP81_RS21020 (4289363) 4289363..4289860 - 498 WP_001670425.1 FimD/PapC N-terminal domain-containing protein -
PQP81_RS21025 (4289984) 4289984..4290814 - 831 WP_001180236.1 fimbria/pilus periplasmic chaperone -
PQP81_RS21030 (4291016) 4291016..4291321 - 306 WP_000370555.1 PapB/FocB family fimbrial expression transcriptional regulator -
PQP81_RS21035 (4291852) 4291852..4291995 + 144 Protein_4112 transposase -
PQP81_RS21040 (4292012) 4292012..4292358 + 347 Protein_4113 Rpn family recombination-promoting nuclease/putative transposase -
PQP81_RS21045 (4292639) 4292639..4292887 - 249 Protein_4114 IS481 family transposase -
PQP81_RS21050 (4293102) 4293102..4293593 - 492 WP_000625912.1 GNAT family N-acetyltransferase Toxin
PQP81_RS21055 (4293590) 4293590..4293883 - 294 WP_001110450.1 DUF1778 domain-containing protein Antitoxin
PQP81_RS21060 (4294200) 4294200..4294422 + 223 Protein_4117 hypothetical protein -
PQP81_RS21065 (4294686) 4294686..4295561 + 876 WP_000921676.1 AraC family transcriptional regulator -
PQP81_RS21070 (4295558) 4295558..4295845 + 288 WP_001269916.1 transcriptional regulator RtsB -
PQP81_RS21075 (4295838) 4295838..4296020 - 183 WP_001670702.1 ATP-binding cassette domain-containing protein -
PQP81_RS21080 (4296040) 4296040..4296139 + 100 Protein_4121 hypothetical protein -
PQP81_RS21085 (4296137) 4296137..4296385 + 249 Protein_4122 hypothetical protein -
PQP81_RS21090 (4296680) 4296680..4297585 - 906 WP_001268200.1 YjiK family protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Genomic island - - 4286191..4295845 9654
- inside Genomic island - - 4282497..4296289 13792


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

GNAT domain

(87-144)

Antitoxin

Vibrio phage ICP1, Orf50

(14-88)


Sequences

Toxin        


Download         Length: 164 a.a.        Molecular weight: 17606.43 Da        Isoelectric Point: 7.7297

>T270951 WP_000625912.1 NZ_CP117378:c4293593-4293102 [Salmonella enterica subsp. enterica serovar Newport]
MISSPEPLHAGHILTPFCCGVDSMDNWLKQRAMKNQTTGASRTFVCCGSDSSVLAYYSLASSAVTTNTAPGRFRRNMPDP
IPIVVLGRLAVDKSLHGQGVGRALVRDAGLRVIQVAETIGIRGMLVHALSDEAREFYQRVGFVPSPMDPMMLMVTLGDLV
ESV

Download         Length: 492 bp

Antitoxin


Download         Length: 98 a.a.        Molecular weight: 10949.56 Da        Isoelectric Point: 8.6141

>AT270951 WP_001110450.1 NZ_CP117378:c4293883-4293590 [Salmonella enterica subsp. enterica serovar Newport]
MPAANSMAMKRETLNLRIKPAERDLIDRAAKARGKNRTDFVLEAARAAAEEALIEQRIIMADPEAYQEFLARLDQTPSPN
AALRKTMQTPAPWEQEK

Download         Length: 294 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A0R9NZI3

Antitoxin

Source ID Structure
AlphaFold DB A0A0R9PGG6

References