Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) relBE/ParE-DnaT
Location 39429..39951 Replicon plasmid pRM079_2
Accession NZ_CP117369
Organism Salmonella enterica subsp. enterica serovar Dublin strain RM079

Toxin (Protein)


Gene name relE Uniprot ID G3CAN5
Locus tag PQQ12_RS25255 Protein ID WP_000220560.1
Coordinates 39670..39951 (+) Length 94 a.a.

Antitoxin (Protein)


Gene name relB Uniprot ID G3CAG1
Locus tag PQQ12_RS25250 Protein ID WP_000121743.1
Coordinates 39429..39680 (+) Length 84 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
PQQ12_RS25225 (PQQ12_25225) 34840..35460 + 621 WP_000864788.1 ParA family protein -
PQQ12_RS25230 (PQQ12_25230) 35512..35742 + 231 WP_000051066.1 plasmid partition protein ParG -
PQQ12_RS25235 (PQQ12_25235) 36381..36734 - 354 WP_001675596.1 DNA distortion polypeptide 3 -
PQQ12_RS25240 (PQQ12_25240) 36871..37317 - 447 WP_001074381.1 hypothetical protein -
PQQ12_RS25245 (PQQ12_25245) 37357..38193 - 837 WP_001575533.1 replication initiation protein -
PQQ12_RS25250 (PQQ12_25250) 39429..39680 + 252 WP_000121743.1 plasmid stabilization protein Antitoxin
PQQ12_RS25255 (PQQ12_25255) 39670..39951 + 282 WP_000220560.1 type II toxin-antitoxin system RelE/ParE family toxin Toxin
PQQ12_RS25260 (PQQ12_25260) 40097..40420 + 324 WP_001181909.1 hypothetical protein -
PQQ12_RS25265 (PQQ12_25265) 40465..40710 + 246 WP_000356542.1 hypothetical protein -
PQQ12_RS25270 (PQQ12_25270) 40700..40915 + 216 WP_001180117.1 hypothetical protein -
PQQ12_RS25275 (PQQ12_25275) 41008..41337 + 330 WP_000866650.1 hypothetical protein -
PQQ12_RS25280 (PQQ12_25280) 41380..41559 + 180 WP_001575529.1 hypothetical protein -
PQQ12_RS25285 (PQQ12_25285) 41581..41778 + 198 WP_001675595.1 hypothetical protein -
PQQ12_RS25290 (PQQ12_25290) 41791..42063 + 273 WP_000160399.1 hypothetical protein -
PQQ12_RS25295 (PQQ12_25295) 42389..42934 + 546 WP_000757691.1 DNA distortion polypeptide 1 -
PQQ12_RS25300 (PQQ12_25300) 42937..44118 + 1182 WP_000539536.1 MobP1 family relaxase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Non-Mobilizable plasmid - faeH / faeI / spvC / spvB 1..73152 73152


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin-antitoxin system, RelE/ParE toxin family

(5-86)

Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 94 a.a.        Molecular weight: 11005.83 Da        Isoelectric Point: 10.5938

>T270866 WP_000220560.1 NZ_CP117369:39670-39951 [Salmonella enterica subsp. enterica serovar Dublin]
MTYELAFDRRALKEWQKLGHTIREQFKKKLAERLENPRVPAARLHGHADRYKIKLRASGYRLVYQVIDEKVVLLVIAVGR
RESSEVYQIADLR

Download         Length: 282 bp

Antitoxin


Download         Length: 84 a.a.        Molecular weight: 9194.43 Da        Isoelectric Point: 4.1683

>AT270866 WP_000121743.1 NZ_CP117369:39429-39680 [Salmonella enterica subsp. enterica serovar Dublin]
MSYQILTTTAASITDLKKNPMGTVAEGEGDAVAILNRNEPAFYCVPPKLYAYYRELAEDAELNAVADERMKNPEIVKVNL
DDL

Download         Length: 252 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB G3CAN5

Antitoxin

Source ID Structure
AlphaFold DB A0A3S5I301

References