Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/HTH(antitoxin) |
| Location | 4771834..4772436 | Replicon | chromosome |
| Accession | NZ_CP117367 | ||
| Organism | Salmonella enterica subsp. enterica serovar Dublin strain RM079 | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | M7S4R6 |
| Locus tag | PQQ12_RS23365 | Protein ID | WP_001159635.1 |
| Coordinates | 4772125..4772436 (-) | Length | 104 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | - |
| Locus tag | PQQ12_RS23360 | Protein ID | WP_000362050.1 |
| Coordinates | 4771834..4772124 (-) | Length | 97 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PQQ12_RS23345 (4769327) | 4769327..4770229 | + | 903 | WP_000331367.1 | formate dehydrogenase subunit beta | - |
| PQQ12_RS23350 (4770226) | 4770226..4770861 | + | 636 | WP_000829025.1 | formate dehydrogenase cytochrome b556 subunit | - |
| PQQ12_RS23355 (4770858) | 4770858..4771787 | + | 930 | WP_000027737.1 | formate dehydrogenase accessory protein FdhE | - |
| PQQ12_RS23360 (4771834) | 4771834..4772124 | - | 291 | WP_000362050.1 | DNA-binding transcriptional regulator | Antitoxin |
| PQQ12_RS23365 (4772125) | 4772125..4772436 | - | 312 | WP_001159635.1 | cytotoxic translational repressor of toxin-antitoxin stability system | Toxin |
| PQQ12_RS23370 (4772654) | 4772654..4773583 | + | 930 | WP_001127708.1 | alpha/beta hydrolase | - |
| PQQ12_RS23375 (4773669) | 4773669..4773980 | + | 312 | WP_000558169.1 | type II toxin-antitoxin system HigB family toxin | - |
| PQQ12_RS23380 (4773977) | 4773977..4774423 | + | 447 | WP_001259012.1 | type II toxin-antitoxin system HigA family antitoxin | - |
| PQQ12_RS23385 (4774438) | 4774438..4775379 | - | 942 | WP_001518251.1 | fatty acid biosynthesis protein FabY | - |
| PQQ12_RS23390 (4775424) | 4775424..4775861 | - | 438 | WP_000560969.1 | D-aminoacyl-tRNA deacylase | - |
| PQQ12_RS23395 (4775858) | 4775858..4776730 | - | 873 | WP_000921423.1 | virulence factor BrkB family protein | - |
| PQQ12_RS23400 (4776724) | 4776724..4777323 | - | 600 | WP_000965695.1 | glucose-1-phosphatase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 104 a.a. Molecular weight: 12340.30 Da Isoelectric Point: 9.4460
>T270861 WP_001159635.1 NZ_CP117367:c4772436-4772125 [Salmonella enterica subsp. enterica serovar Dublin]
MQFIETELFTEDVKKLLDEDEYHKLQVFMAQHPDCGDVIQETGGLRKMRWGARGKGKRSGVRIIYFHRSQRYEIRLLLIY
QKGIKDDLTPQEKAVLRMLNERW
MQFIETELFTEDVKKLLDEDEYHKLQVFMAQHPDCGDVIQETGGLRKMRWGARGKGKRSGVRIIYFHRSQRYEIRLLLIY
QKGIKDDLTPQEKAVLRMLNERW
Download Length: 312 bp
Antitoxin
Download Length: 97 a.a. Molecular weight: 10971.59 Da Isoelectric Point: 10.6525
>AT270861 WP_000362050.1 NZ_CP117367:c4772124-4771834 [Salmonella enterica subsp. enterica serovar Dublin]
MDKVLFERLTQSMSQMNEIIEGTREPSRTFHIDAMKIKEIRQASGLSQSKFAELISVNVDTLRNWEQGRRSPTGPAKALL
RAIANDPRNVIQALRY
MDKVLFERLTQSMSQMNEIIEGTREPSRTFHIDAMKIKEIRQASGLSQSKFAELISVNVDTLRNWEQGRRSPTGPAKALL
RAIANDPRNVIQALRY
Download Length: 291 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|