Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | relBE/ParE-RelB |
| Location | 4355861..4356377 | Replicon | chromosome |
| Accession | NZ_CP117367 | ||
| Organism | Salmonella enterica subsp. enterica serovar Dublin strain RM079 | ||
Toxin (Protein)
| Gene name | relE | Uniprot ID | M7RIY5 |
| Locus tag | PQQ12_RS21450 | Protein ID | WP_000220574.1 |
| Coordinates | 4355861..4356145 (-) | Length | 95 a.a. |
Antitoxin (Protein)
| Gene name | relB | Uniprot ID | V7ISI8 |
| Locus tag | PQQ12_RS21455 | Protein ID | WP_000212724.1 |
| Coordinates | 4356135..4356377 (-) | Length | 81 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PQQ12_RS21435 (4350977) | 4350977..4352629 | + | 1653 | WP_001751520.1 | alpha,alpha-phosphotrehalase | - |
| PQQ12_RS21440 (4353038) | 4353038..4355176 | + | 2139 | WP_000187818.1 | anaerobic ribonucleoside-triphosphate reductase | - |
| PQQ12_RS21445 (4355393) | 4355393..4355857 | + | 465 | WP_001009173.1 | anaerobic ribonucleoside-triphosphate reductase-activating protein | - |
| PQQ12_RS21450 (4355861) | 4355861..4356145 | - | 285 | WP_000220574.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| PQQ12_RS21455 (4356135) | 4356135..4356377 | - | 243 | WP_000212724.1 | type II toxin-antitoxin system RelB/DinJ family antitoxin | Antitoxin |
| PQQ12_RS21460 (4356455) | 4356455..4358368 | - | 1914 | WP_001212138.1 | PRD domain-containing protein | - |
| PQQ12_RS21465 (4358385) | 4358385..4359125 | - | 741 | WP_000779259.1 | KDGP aldolase family protein | - |
| PQQ12_RS21470 (4359122) | 4359122..4360240 | - | 1119 | WP_001139169.1 | DgaE family pyridoxal phosphate-dependent ammonia lyase | - |
| PQQ12_RS21475 (4360224) | 4360224..4361357 | - | 1134 | WP_000459958.1 | amidohydrolase/deacetylase family metallohydrolase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 95 a.a. Molecular weight: 10869.68 Da Isoelectric Point: 9.8739
>T270859 WP_000220574.1 NZ_CP117367:c4356145-4355861 [Salmonella enterica subsp. enterica serovar Dublin]
MTYELEFDPRALKEWHKLGDTVKAQIKKKLADVLLDPRIDSARLNGLPDCYKIKLKSSGYRLVYQVRDEVVIVFVVAVGK
REHSAVYHDANKRL
MTYELEFDPRALKEWHKLGDTVKAQIKKKLADVLLDPRIDSARLNGLPDCYKIKLKSSGYRLVYQVRDEVVIVFVVAVGK
REHSAVYHDANKRL
Download Length: 285 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | M7RIY5 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A5H5JRI5 |