Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) ccdAB/CcdA(antitoxin)
Location 4314696..4315246 Replicon chromosome
Accession NZ_CP117367
Organism Salmonella enterica subsp. enterica serovar Dublin strain RM079

Toxin (Protein)


Gene name ccdB Uniprot ID M7RJ32
Locus tag PQQ12_RS21245 Protein ID WP_001199743.1
Coordinates 4314696..4315004 (-) Length 103 a.a.

Antitoxin (Protein)


Gene name ccdA Uniprot ID M7RP97
Locus tag PQQ12_RS21250 Protein ID WP_001118105.1
Coordinates 4315007..4315246 (-) Length 80 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
PQQ12_RS21225 (4311270) 4311270..4312010 - 741 WP_001575372.1 SEF14/SEF18 fimbria chaperone SefB -
PQQ12_RS21230 (4312132) 4312132..4312629 - 498 WP_001231942.1 SEF14 fimbria major subunit SefA -
PQQ12_RS21235 (4312985) 4312985..4314118 + 1134 Protein_4161 IS3 family transposase -
PQQ12_RS21240 (4314150) 4314150..4314290 - 141 Protein_4162 Arm DNA-binding domain-containing protein -
PQQ12_RS21245 (4314696) 4314696..4315004 - 309 WP_001199743.1 CcdB family protein Toxin
PQQ12_RS21250 (4315007) 4315007..4315246 - 240 WP_001118105.1 type II toxin-antitoxin system CcdA family antitoxin Antitoxin
PQQ12_RS21255 (4315355) 4315355..4315603 - 249 WP_000168389.1 ribbon-helix-helix domain-containing protein -
PQQ12_RS21260 (4315794) 4315794..4316225 - 432 Protein_4166 helix-turn-helix domain-containing protein -
PQQ12_RS21270 (4316982) 4316982..4318001 + 1020 WP_000152558.1 NAD(P)-dependent alcohol dehydrogenase -
PQQ12_RS21275 (4318029) 4318029..4318559 - 531 WP_000896758.1 gluconokinase -
PQQ12_RS21280 (4318776) 4318776..4319807 + 1032 WP_000453348.1 L-idonate 5-dehydrogenase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside IScluster/Tn - - 4313077..4316180 3103


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin CcdB

(2-101)

Antitoxin

Post-segregation antitoxin CcdA

(9-79)


Sequences

Toxin        


Download         Length: 103 a.a.        Molecular weight: 11845.67 Da        Isoelectric Point: 6.7228

>T270858 WP_001199743.1 NZ_CP117367:c4315004-4314696 [Salmonella enterica subsp. enterica serovar Dublin]
MQYMVYRNKGNSKAYPYLLDVQSDIIDELHTRMVIPLFPVSRLVNNPVKRLTPTLNVEGNDYLVMTHEMASIRLSQIGDE
VMDVRSHRQTIKNALDFIFDGF

Download         Length: 309 bp

Antitoxin


Download         Length: 80 a.a.        Molecular weight: 8719.90 Da        Isoelectric Point: 6.4633

>AT270858 WP_001118105.1 NZ_CP117367:c4315246-4315007 [Salmonella enterica subsp. enterica serovar Dublin]
MPGMSVRHKKTVSVTLEPALLQQARDAGINLSAVLTAALKEEISATGVERWKAENRAGLQELNRITDEHGLLSDDYRTF

Download         Length: 240 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A6C6Z9V9

Antitoxin

Source ID Structure
AlphaFold DB A0A5H9SZK8

References