Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/HTH(antitoxin) |
| Location | 4643672..4644274 | Replicon | chromosome |
| Accession | NZ_CP117365 | ||
| Organism | Salmonella enterica subsp. enterica serovar Newport strain RM089 | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | C0Q3J8 |
| Locus tag | PQP78_RS22690 | Protein ID | WP_001159630.1 |
| Coordinates | 4643963..4644274 (-) | Length | 104 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | - |
| Locus tag | PQP78_RS22685 | Protein ID | WP_000362050.1 |
| Coordinates | 4643672..4643962 (-) | Length | 97 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PQP78_RS22670 (4641167) | 4641167..4642069 | + | 903 | WP_000331364.1 | formate dehydrogenase subunit beta | - |
| PQP78_RS22675 (4642066) | 4642066..4642699 | + | 634 | Protein_4427 | formate dehydrogenase cytochrome b556 subunit | - |
| PQP78_RS22680 (4642696) | 4642696..4643625 | + | 930 | WP_000027730.1 | formate dehydrogenase accessory protein FdhE | - |
| PQP78_RS22685 (4643672) | 4643672..4643962 | - | 291 | WP_000362050.1 | DNA-binding transcriptional regulator | Antitoxin |
| PQP78_RS22690 (4643963) | 4643963..4644274 | - | 312 | WP_001159630.1 | cytotoxic translational repressor of toxin-antitoxin stability system | Toxin |
| PQP78_RS22695 (4644492) | 4644492..4645421 | + | 930 | WP_001127704.1 | alpha/beta hydrolase | - |
| PQP78_RS22700 (4645507) | 4645507..4645817 | + | 311 | Protein_4432 | type II toxin-antitoxin system HigB family toxin | - |
| PQP78_RS22705 (4645814) | 4645814..4646260 | + | 447 | WP_001259011.1 | type II toxin-antitoxin system HigA family antitoxin | - |
| PQP78_RS22710 (4646275) | 4646275..4647216 | - | 942 | WP_001518251.1 | fatty acid biosynthesis protein FabY | - |
| PQP78_RS22715 (4647261) | 4647261..4647698 | - | 438 | WP_000560969.1 | D-aminoacyl-tRNA deacylase | - |
| PQP78_RS22720 (4647695) | 4647695..4648567 | - | 873 | WP_000921423.1 | virulence factor BrkB family protein | - |
| PQP78_RS22725 (4648561) | 4648561..4649160 | - | 600 | WP_000965695.1 | glucose-1-phosphatase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 104 a.a. Molecular weight: 12326.27 Da Isoelectric Point: 9.4460
>T270841 WP_001159630.1 NZ_CP117365:c4644274-4643963 [Salmonella enterica subsp. enterica serovar Newport]
MQFIETELFTEDVKKLLDDDEYHKLQVFMAQHPDCGDVIQETGGLRKMRWGARGKGKRSGVRIIYFHRSQRYEIRLLLIY
QKGIKDDLTPQEKAVLRMLNERW
MQFIETELFTEDVKKLLDDDEYHKLQVFMAQHPDCGDVIQETGGLRKMRWGARGKGKRSGVRIIYFHRSQRYEIRLLLIY
QKGIKDDLTPQEKAVLRMLNERW
Download Length: 312 bp
Antitoxin
Download Length: 97 a.a. Molecular weight: 10971.59 Da Isoelectric Point: 10.6525
>AT270841 WP_000362050.1 NZ_CP117365:c4643962-4643672 [Salmonella enterica subsp. enterica serovar Newport]
MDKVLFERLTQSMSQMNEIIEGTREPSRTFHIDAMKIKEIRQASGLSQSKFAELISVNVDTLRNWEQGRRSPTGPAKALL
RAIANDPRNVIQALRY
MDKVLFERLTQSMSQMNEIIEGTREPSRTFHIDAMKIKEIRQASGLSQSKFAELISVNVDTLRNWEQGRRSPTGPAKALL
RAIANDPRNVIQALRY
Download Length: 291 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|