Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | relBE/ParE-RelB |
| Location | 4140345..4140861 | Replicon | chromosome |
| Accession | NZ_CP117365 | ||
| Organism | Salmonella enterica subsp. enterica serovar Newport strain RM089 | ||
Toxin (Protein)
| Gene name | relE | Uniprot ID | A0A0R9NWE9 |
| Locus tag | PQP78_RS20175 | Protein ID | WP_000220579.1 |
| Coordinates | 4140345..4140629 (-) | Length | 95 a.a. |
Antitoxin (Protein)
| Gene name | relB | Uniprot ID | V7ISI8 |
| Locus tag | PQP78_RS20180 | Protein ID | WP_000212724.1 |
| Coordinates | 4140619..4140861 (-) | Length | 81 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PQP78_RS20160 (4135461) | 4135461..4137113 | + | 1653 | WP_000155055.1 | alpha,alpha-phosphotrehalase | - |
| PQP78_RS20165 (4137522) | 4137522..4139660 | + | 2139 | WP_000187821.1 | anaerobic ribonucleoside-triphosphate reductase | - |
| PQP78_RS20170 (4139877) | 4139877..4140341 | + | 465 | WP_001009175.1 | anaerobic ribonucleoside-triphosphate reductase-activating protein | - |
| PQP78_RS20175 (4140345) | 4140345..4140629 | - | 285 | WP_000220579.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| PQP78_RS20180 (4140619) | 4140619..4140861 | - | 243 | WP_000212724.1 | type II toxin-antitoxin system RelB/DinJ family antitoxin | Antitoxin |
| PQP78_RS20185 (4140939) | 4140939..4142852 | - | 1914 | WP_001212131.1 | BglG family transcription antiterminator | - |
| PQP78_RS20190 (4142869) | 4142869..4143609 | - | 741 | WP_000779247.1 | KDGP aldolase family protein | - |
| PQP78_RS20195 (4143606) | 4143606..4144724 | - | 1119 | WP_001139182.1 | DgaE family pyridoxal phosphate-dependent ammonia lyase | - |
| PQP78_RS20200 (4144708) | 4144708..4145841 | - | 1134 | WP_274891857.1 | amidohydrolase/deacetylase family metallohydrolase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 95 a.a. Molecular weight: 10884.70 Da Isoelectric Point: 10.0482
>T270839 WP_000220579.1 NZ_CP117365:c4140629-4140345 [Salmonella enterica subsp. enterica serovar Newport]
MTYELEFDPRALKEWHKLGDTVKAQLKKKLADVLLNPRIDSARLNGLPDCYKIKLKSSGYRLVYQVRDDVVIVFVVAVGK
REHSAVYHDTNKRL
MTYELEFDPRALKEWHKLGDTVKAQLKKKLADVLLNPRIDSARLNGLPDCYKIKLKSSGYRLVYQVRDDVVIVFVVAVGK
REHSAVYHDTNKRL
Download Length: 285 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0R9NWE9 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A5H5JRI5 |