Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | relBE/ParE-RelB |
| Location | 4168325..4168841 | Replicon | chromosome |
| Accession | NZ_CP117348 | ||
| Organism | Salmonella enterica subsp. enterica serovar Heidelberg strain RM101 | ||
Toxin (Protein)
| Gene name | relE | Uniprot ID | A0A3V5VNJ7 |
| Locus tag | PQQ11_RS20270 | Protein ID | WP_000220577.1 |
| Coordinates | 4168325..4168609 (-) | Length | 95 a.a. |
Antitoxin (Protein)
| Gene name | relB | Uniprot ID | V7ISI8 |
| Locus tag | PQQ11_RS20275 | Protein ID | WP_000212724.1 |
| Coordinates | 4168599..4168841 (-) | Length | 81 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PQQ11_RS20255 (4163441) | 4163441..4165093 | + | 1653 | WP_000155047.1 | alpha,alpha-phosphotrehalase | - |
| PQQ11_RS20260 (4165502) | 4165502..4167640 | + | 2139 | WP_000187818.1 | anaerobic ribonucleoside-triphosphate reductase | - |
| PQQ11_RS20265 (4167857) | 4167857..4168321 | + | 465 | WP_001009173.1 | anaerobic ribonucleoside-triphosphate reductase-activating protein | - |
| PQQ11_RS20270 (4168325) | 4168325..4168609 | - | 285 | WP_000220577.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| PQQ11_RS20275 (4168599) | 4168599..4168841 | - | 243 | WP_000212724.1 | type II toxin-antitoxin system RelB/DinJ family antitoxin | Antitoxin |
| PQQ11_RS20280 (4168919) | 4168919..4170832 | - | 1914 | WP_274897982.1 | BglG family transcription antiterminator | - |
| PQQ11_RS20285 (4170849) | 4170849..4171589 | - | 741 | WP_000779250.1 | KDGP aldolase family protein | - |
| PQQ11_RS20290 (4171586) | 4171586..4172704 | - | 1119 | WP_001139173.1 | DgaE family pyridoxal phosphate-dependent ammonia lyase | - |
| PQQ11_RS20295 (4172688) | 4172688..4173821 | - | 1134 | WP_000459930.1 | amidohydrolase/deacetylase family metallohydrolase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 95 a.a. Molecular weight: 10912.71 Da Isoelectric Point: 9.8739
>T270708 WP_000220577.1 NZ_CP117348:c4168609-4168325 [Salmonella enterica subsp. enterica serovar Heidelberg]
MTYELEFDPRALKEWHKLGDTVKAQLKKKLADVLLNPRIDSARLNDLPDCYKIKLKSSGYRLVYQVRDDVVIVFVVAVGK
REHSAVYHDANKRL
MTYELEFDPRALKEWHKLGDTVKAQLKKKLADVLLNPRIDSARLNDLPDCYKIKLKSSGYRLVYQVRDDVVIVFVVAVGK
REHSAVYHDANKRL
Download Length: 285 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A3V5VNJ7 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A5H5JRI5 |