Detailed information of TA system TA270605

Bioinformatically predicted

Overview

TA module

• Type: II
• Classification (family/domain): higBA (relBE)/COG4683-HTH_37
• Location: 135138..135795
• Replicon: plasmid pRM052_1
• Accession: NZ_CP117337
• Organism: Salmonella enterica subsp. enterica serovar Dublin strain RM052

Toxin (Protein)

• Gene name: higB
• Uniprot ID: U3PDC3
• Locus tag: PQP91_RS24605
• Protein ID: WP_000270043.1
• Coordinates: 135445..135795 (-)
• Length: 117 a.a.

Antitoxin (Protein)

• Gene name: higA
• Uniprot ID: -
• Locus tag: PQP91_RS24600
• Protein ID: WP_000124640.1
• Coordinates: 135138..135440 (-)
• Length: 101 a.a.

Genomic Context

Locus tag	Coordinates	Strand	Size (bp)	Protein ID	Product	Description
PQP91_RS24555 (PQP91_24555)	130763..131191	+	429	WP_000591074.1	hypothetical protein	-
PQP91_RS24560 (PQP91_24560)	131248..131607	+	360	WP_000422768.1	hypothetical protein	-
PQP91_RS24565 (PQP91_24565)	131607..132053	+	447	WP_000919345.1	Fe3+-siderophore ABC transporter permease	-
PQP91_RS24570 (PQP91_24570)	132050..132568	+	519	WP_000210756.1	nitrite reductase	-
PQP91_RS24575 (PQP91_24575)	132568..132798	+	231	WP_000972663.1	hypothetical protein	-
PQP91_RS24580 (PQP91_24580)	132785..133642	+	858	WP_001167032.1	hypothetical protein	-
PQP91_RS24585 (PQP91_24585)	133873..134400	+	528	WP_001236377.1	thermonuclease family protein	-
PQP91_RS24590 (PQP91_24590)	134458..134730	+	273	WP_001043047.1	HU family DNA-binding protein	-
PQP91_RS24595 (PQP91_24595)	134818..135111	+	294	WP_001239997.1	chromosome segregation protein ParM	-
PQP91_RS24600 (PQP91_24600)	135138..135440	-	303	WP_000124640.1	XRE family transcriptional regulator	Antitoxin
PQP91_RS24605 (PQP91_24605)	135445..135795	-	351	WP_000270043.1	type II toxin-antitoxin system RelE/ParE family toxin	Toxin
PQP91_RS24610 (PQP91_24610)	135958..136506	+	549	WP_001061574.1	transcriptional regulator	-
PQP91_RS24615 (PQP91_24615)	136847..137041	+	195	WP_000343597.1	hypothetical protein	-
PQP91_RS24620 (PQP91_24620)	137052..137423	+	372	WP_000516916.1	hypothetical protein	-
PQP91_RS24625 (PQP91_24625)	137416..137886	+	471	WP_001281821.1	hypothetical protein	-
PQP91_RS24630 (PQP91_24630)	137901..138236	-	336	WP_000683476.1	hypothetical protein	-
PQP91_RS24635 (PQP91_24635)	138333..138821	+	489	WP_001273096.1	DUF1643 domain-containing protein	-
PQP91_RS24640 (PQP91_24640)	138824..139321	+	498	WP_000062185.1	hypothetical protein	-
PQP91_RS24645 (PQP91_24645)	139536..140240	-	705	WP_001067855.1	IS6-like element IS26 family transposase	-

Associated MGEs

MGE detail	Similar MGEs	Relative position	MGE Type	Cargo ARG	Virulence gene	Coordinates	Length (bp)
	-	inside	Conjugative plasmid	floR / tet(A) / aph(6)-Id / aph(3'')-Ib / sul2	faeH / faeI / spvC / spvB	1..150540	150540
	-	flank	IS/Tn	-	-	139536..140240	704

Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.

Domains

Predicted by InterproScan

Toxin

• Toxin HigB-like (12-106)

Antitoxin

• Cro/C1-type helix-turn-helix domain (33-79)

Sequences

Toxin

Protein

• Length: 117 a.a.
• Molecular weight: 13328.21 Da
• Isoelectric Point: 5.2421

>T270605 WP_000270043.1 NZ_CP117337:c135795-135445 [Salmonella enterica subsp. enterica serovar Dublin]
MWVIETTDTFDEWFDALDDTDRANVLASMMVLRDRGPMLSRPYADTVNGSSYSNMKELRVQSKGDPIRAFFAFDPKRKGI
LLCAGNKTGDEKRFYEVMIPIADREFAAHLDKLKKE

Nucleotide

• Length: 351 bp

Antitoxin

Protein

• Length: 101 a.a.
• Molecular weight: 11006.73 Da
• Isoelectric Point: 7.2036

>AT270605 WP_000124640.1 NZ_CP117337:c135440-135138 [Salmonella enterica subsp. enterica serovar Dublin]
MARTLDQMLATEKPEVVAKAQKAATEMLLNIHLAELRDRMNLTQGEIAASLGVRQPTVSEMEKPGRDLKLSSIKRYVEAS
GGKLRLDVELPDGTHYGFAV

Nucleotide

• Length: 303 bp

Structures

Toxin

• AlphaFold DB: A0A7G8AFB9