Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | hok-sok/- |
| Location | 68556..68820 | Replicon | plasmid pRM106_1 |
| Accession | NZ_CP117328 | ||
| Organism | Salmonella enterica subsp. enterica serovar Saintpaul strain RM106 | ||
Toxin (Protein)
| Gene name | pndA | Uniprot ID | E6BRV3 |
| Locus tag | PQP95_RS23140 | Protein ID | WP_001303307.1 |
| Coordinates | 68668..68820 (+) | Length | 51 a.a. |
Antitoxin (RNA)
| Gene name | pndB | ||
| Locus tag | - | ||
| Coordinates | 68556..68618 (-) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PQP95_RS23125 (64658) | 64658..65728 | - | 1071 | WP_000151582.1 | IncI1-type conjugal transfer protein TrbB | - |
| PQP95_RS23130 (65747) | 65747..66955 | - | 1209 | WP_000121273.1 | IncI1-type conjugal transfer protein TrbA | - |
| - (67135) | 67135..67195 | - | 61 | NuclAT_1 | - | - |
| - (67135) | 67135..67195 | - | 61 | NuclAT_1 | - | - |
| - (67135) | 67135..67195 | - | 61 | NuclAT_1 | - | - |
| - (67135) | 67135..67195 | - | 61 | NuclAT_1 | - | - |
| PQP95_RS23135 (67262) | 67262..68041 | - | 780 | WP_275450201.1 | protein FinQ | - |
| - (68556) | 68556..68618 | - | 63 | NuclAT_0 | - | Antitoxin |
| - (68556) | 68556..68618 | - | 63 | NuclAT_0 | - | Antitoxin |
| - (68556) | 68556..68618 | - | 63 | NuclAT_0 | - | Antitoxin |
| - (68556) | 68556..68618 | - | 63 | NuclAT_0 | - | Antitoxin |
| PQP95_RS23140 (68668) | 68668..68820 | + | 153 | WP_001303307.1 | Hok/Gef family protein | Toxin |
| PQP95_RS23145 (68892) | 68892..69143 | - | 252 | WP_001291965.1 | hypothetical protein | - |
| - (69530) | 69530..69581 | - | 52 | NuclAT_2 | - | - |
| - (69530) | 69530..69581 | - | 52 | NuclAT_2 | - | - |
| - (69530) | 69530..69581 | - | 52 | NuclAT_2 | - | - |
| - (69530) | 69530..69581 | - | 52 | NuclAT_2 | - | - |
| PQP95_RS23150 (70067) | 70067..70243 | - | 177 | WP_001054900.1 | hypothetical protein | - |
| PQP95_RS23155 (70452) | 70452..70661 | - | 210 | WP_001140545.1 | hemolysin expression modulator Hha | - |
| PQP95_RS23160 (70759) | 70759..71373 | - | 615 | WP_000578649.1 | plasmid IncI1-type surface exclusion protein ExcA | - |
| PQP95_RS23165 (71449) | 71449..73617 | - | 2169 | WP_000698360.1 | IncI1-type conjugal transfer membrane protein TraY | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Conjugative plasmid | floR / tet(A) / aph(6)-Id / aph(3'')-Ib / sul2 / blaTEM-1A | - | 1..114639 | 114639 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 51 a.a. Molecular weight: 5817.21 Da Isoelectric Point: 8.7948
>T270541 WP_001303307.1 NZ_CP117328:68668-68820 [Salmonella enterica subsp. enterica serovar Saintpaul]
MPQRTFLMMLIVICVTILCFVWMVRDSLCVLRLQQGNTVLVATLAYEVKR
MPQRTFLMMLIVICVTILCFVWMVRDSLCVLRLQQGNTVLVATLAYEVKR
Download Length: 153 bp
Antitoxin
Download Length: 63 bp
>AT270541 NZ_CP117328:c68618-68556 [Salmonella enterica subsp. enterica serovar Saintpaul]
TCGAAGCATTACAGTAGAGCCCTTGGTTGATTGATAAAAAAATCTCCAGGGGCTTTCTGCTGT
TCGAAGCATTACAGTAGAGCCCTTGGTTGATTGATAAAAAAATCTCCAGGGGCTTTCTGCTGT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
