Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/HigB-HigA |
| Location | 4585325..4586079 | Replicon | chromosome |
| Accession | NZ_CP117326 | ||
| Organism | Salmonella enterica subsp. enterica serovar Newport strain RM108 | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | B5F003 |
| Locus tag | PQQ05_RS22245 | Protein ID | WP_000558166.1 |
| Coordinates | 4585325..4585636 (+) | Length | 104 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | - |
| Locus tag | PQQ05_RS22250 | Protein ID | WP_001259011.1 |
| Coordinates | 4585633..4586079 (+) | Length | 149 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PQQ05_RS22215 (4580983) | 4580983..4581885 | + | 903 | WP_000331364.1 | formate dehydrogenase subunit beta | - |
| PQQ05_RS22220 (4581882) | 4581882..4582517 | + | 636 | WP_274891226.1 | formate dehydrogenase cytochrome b556 subunit | - |
| PQQ05_RS22225 (4582514) | 4582514..4583443 | + | 930 | WP_000027730.1 | formate dehydrogenase accessory protein FdhE | - |
| PQQ05_RS22230 (4583490) | 4583490..4583780 | - | 291 | WP_000362050.1 | DNA-binding transcriptional regulator | - |
| PQQ05_RS22235 (4583781) | 4583781..4584092 | - | 312 | WP_001159630.1 | cytotoxic translational repressor of toxin-antitoxin stability system | - |
| PQQ05_RS22240 (4584310) | 4584310..4585239 | + | 930 | WP_001127704.1 | alpha/beta hydrolase | - |
| PQQ05_RS22245 (4585325) | 4585325..4585636 | + | 312 | WP_000558166.1 | type II toxin-antitoxin system HigB family toxin | Toxin |
| PQQ05_RS22250 (4585633) | 4585633..4586079 | + | 447 | WP_001259011.1 | type II toxin-antitoxin system HigA family antitoxin | Antitoxin |
| PQQ05_RS22255 (4586094) | 4586094..4587035 | - | 942 | WP_001518251.1 | fatty acid biosynthesis protein FabY | - |
| PQQ05_RS22260 (4587080) | 4587080..4587517 | - | 438 | WP_000560969.1 | D-aminoacyl-tRNA deacylase | - |
| PQQ05_RS22265 (4587514) | 4587514..4588386 | - | 873 | WP_000921423.1 | virulence factor BrkB family protein | - |
| PQQ05_RS22270 (4588380) | 4588380..4588979 | - | 600 | WP_000965695.1 | glucose-1-phosphatase | - |
| PQQ05_RS22275 (4589170) | 4589170..4589973 | - | 804 | WP_000059693.1 | DeoR/GlpR family DNA-binding transcription regulator | - |
| PQQ05_RS22280 (4590007) | 4590007..4590903 | - | 897 | WP_001520529.1 | sugar kinase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 104 a.a. Molecular weight: 12432.40 Da Isoelectric Point: 9.5334
>T270520 WP_000558166.1 NZ_CP117326:4585325-4585636 [Salmonella enterica subsp. enterica serovar Newport]
VHVISRKPFNEAMLMYPNHELALTELLNVLEKKTFTQPEEMKRYIPSLDNFKYRDKWWVIDVSGNSLRLISYIDFRLHKI
FVKHIVSHAEYDKLTAYYRGNKE
VHVISRKPFNEAMLMYPNHELALTELLNVLEKKTFTQPEEMKRYIPSLDNFKYRDKWWVIDVSGNSLRLISYIDFRLHKI
FVKHIVSHAEYDKLTAYYRGNKE
Download Length: 312 bp
Antitoxin
Download Length: 149 a.a. Molecular weight: 16734.08 Da Isoelectric Point: 6.6451
>AT270520 WP_001259011.1 NZ_CP117326:4585633-4586079 [Salmonella enterica subsp. enterica serovar Newport]
MRTHRQMDATSAKKIVDTFSDAVKTVPLMGEDRNDNEYRRALALVEFLVDHDDLENPLFELLCARISEYEKHAPEFKALN
QHLEKTPPGVSVLRTLMDQYGLKAADLANELGSKSNVSNILNGRRALTVNHIKALTQRFKLPADAFIE
MRTHRQMDATSAKKIVDTFSDAVKTVPLMGEDRNDNEYRRALALVEFLVDHDDLENPLFELLCARISEYEKHAPEFKALN
QHLEKTPPGVSVLRTLMDQYGLKAADLANELGSKSNVSNILNGRRALTVNHIKALTQRFKLPADAFIE
Download Length: 447 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|