Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) relBE/ParE-RelB
Location 4110966..4111482 Replicon chromosome
Accession NZ_CP117326
Organism Salmonella enterica subsp. enterica serovar Newport strain RM108

Toxin (Protein)


Gene name relE Uniprot ID A0A0R9NWE9
Locus tag PQQ05_RS19935 Protein ID WP_000220579.1
Coordinates 4110966..4111250 (-) Length 95 a.a.

Antitoxin (Protein)


Gene name relB Uniprot ID V7ISI8
Locus tag PQQ05_RS19940 Protein ID WP_000212724.1
Coordinates 4111240..4111482 (-) Length 81 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
PQQ05_RS19920 (4106082) 4106082..4107734 + 1653 WP_000155055.1 alpha,alpha-phosphotrehalase -
PQQ05_RS19925 (4108143) 4108143..4110281 + 2139 WP_000187821.1 anaerobic ribonucleoside-triphosphate reductase -
PQQ05_RS19930 (4110498) 4110498..4110962 + 465 WP_001009175.1 anaerobic ribonucleoside-triphosphate reductase-activating protein -
PQQ05_RS19935 (4110966) 4110966..4111250 - 285 WP_000220579.1 type II toxin-antitoxin system RelE/ParE family toxin Toxin
PQQ05_RS19940 (4111240) 4111240..4111482 - 243 WP_000212724.1 type II toxin-antitoxin system RelB/DinJ family antitoxin Antitoxin
PQQ05_RS19945 (4111560) 4111560..4113473 - 1914 WP_274895347.1 BglG family transcription antiterminator -
PQQ05_RS19950 (4113490) 4113490..4114230 - 741 WP_000779247.1 KDGP aldolase family protein -
PQQ05_RS19955 (4114227) 4114227..4115345 - 1119 WP_001139182.1 DgaE family pyridoxal phosphate-dependent ammonia lyase -
PQQ05_RS19960 (4115329) 4115329..4116462 - 1134 WP_000459949.1 amidohydrolase/deacetylase family metallohydrolase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Prophage - - 4108143..4162467 54324


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin-antitoxin system, RelE/ParE toxin family

(4-83)

Antitoxin

RelB antitoxin/Antitoxin DinJ

(1-80)


Sequences

Toxin        


Download         Length: 95 a.a.        Molecular weight: 10884.70 Da        Isoelectric Point: 10.0482

>T270517 WP_000220579.1 NZ_CP117326:c4111250-4110966 [Salmonella enterica subsp. enterica serovar Newport]
MTYELEFDPRALKEWHKLGDTVKAQLKKKLADVLLNPRIDSARLNGLPDCYKIKLKSSGYRLVYQVRDDVVIVFVVAVGK
REHSAVYHDTNKRL

Download         Length: 285 bp

Antitoxin


Download         Length: 81 a.a.        Molecular weight: 8961.34 Da        Isoelectric Point: 5.0651

>AT270517 WP_000212724.1 NZ_CP117326:c4111482-4111240 [Salmonella enterica subsp. enterica serovar Newport]
MATLNVRLDDKLKNEAYAVLEKLNITPTEAVRLLFQYVAETGRMPVKTVTLSDSEDALIQTVRERLSSPQKGIKVSLDDL

Download         Length: 243 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A0R9NWE9

Antitoxin

Source ID Structure
AlphaFold DB A0A5H5JRI5

References