Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | cptAB/Cpta(toxin) |
| Location | 805615..806263 | Replicon | chromosome |
| Accession | NZ_CP117293 | ||
| Organism | Salmonella enterica subsp. enterica serovar Typhi strain S2 | ||
Toxin (Protein)
| Gene name | cptA | Uniprot ID | A0A715BCB4 |
| Locus tag | PRW95_RS03910 | Protein ID | WP_000244762.1 |
| Coordinates | 805862..806263 (+) | Length | 134 a.a. |
Antitoxin (Protein)
| Gene name | cptB | Uniprot ID | S5MU13 |
| Locus tag | PRW95_RS03905 | Protein ID | WP_000351186.1 |
| Coordinates | 805615..805881 (+) | Length | 89 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PRW95_RS03885 (PRW95_03885) | 801543..802976 | - | 1434 | WP_001230148.1 | 6-phospho-beta-glucosidase BglA | - |
| PRW95_RS03890 (PRW95_03890) | 803135..803446 | + | 312 | WP_001182971.1 | N(4)-acetylcytidine aminohydrolase | - |
| PRW95_RS03895 (PRW95_03895) | 803610..804269 | + | 660 | WP_000250289.1 | hemolysin III family protein | - |
| PRW95_RS03900 (PRW95_03900) | 804385..805365 | - | 981 | WP_000874170.1 | tRNA-modifying protein YgfZ | - |
| PRW95_RS03905 (PRW95_03905) | 805615..805881 | + | 267 | WP_000351186.1 | FAD assembly factor SdhE | Antitoxin |
| PRW95_RS03910 (PRW95_03910) | 805862..806263 | + | 402 | WP_000244762.1 | protein YgfX | Toxin |
| PRW95_RS03915 (PRW95_03915) | 806328..806849 | - | 522 | WP_001055885.1 | flavodoxin FldB | - |
| PRW95_RS03920 (PRW95_03920) | 806962..807858 | + | 897 | WP_000434302.1 | site-specific tyrosine recombinase XerD | - |
| PRW95_RS03925 (PRW95_03925) | 807882..808595 | + | 714 | WP_000745614.1 | bifunctional protein-disulfide isomerase/oxidoreductase DsbC | - |
| PRW95_RS03930 (PRW95_03930) | 808601..810334 | + | 1734 | WP_000813396.1 | single-stranded-DNA-specific exonuclease RecJ | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 134 a.a. Molecular weight: 15773.75 Da Isoelectric Point: 10.7537
>T270286 WP_000244762.1 NZ_CP117293:805862-806263 [Salmonella enterica subsp. enterica serovar Typhi]
VVLWQSDLRVSWRAQWISLLLHGLVAAVILLMPWPLSYTPLWMILLSLVVFDCVRSQRRINTCQGEIKLLMDGRLRWQGQ
DWTLLRPPWLLKSGMVLRLRAESGRHQHLWLAADSMEEAEWRELRRILLQQPI
VVLWQSDLRVSWRAQWISLLLHGLVAAVILLMPWPLSYTPLWMILLSLVVFDCVRSQRRINTCQGEIKLLMDGRLRWQGQ
DWTLLRPPWLLKSGMVLRLRAESGRHQHLWLAADSMEEAEWRELRRILLQQPI
Download Length: 402 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A715BCB4 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A5I0YWH4 |