Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) parDE/ParE-CC2985
Location 371824..372356 Replicon plasmid pRt1078
Accession NZ_CP117256
Organism Rhizobium tumorigenes strain 1078

Toxin (Protein)


Gene name parE Uniprot ID -
Locus tag PR017_RS19525 Protein ID WP_111219181.1
Coordinates 371824..372117 (-) Length 98 a.a.

Antitoxin (Protein)


Gene name parD Uniprot ID -
Locus tag PR017_RS19530 Protein ID WP_111219220.1
Coordinates 372114..372356 (-) Length 81 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
PR017_RS19495 (PR017_19495) 367687..369231 + 1545 WP_111219177.1 Fic family protein -
PR017_RS19500 (PR017_19500) 369344..369892 + 549 WP_111219179.1 YcxB family protein -
PR017_RS19505 (PR017_19505) 369937..370041 + 105 Protein_349 exonuclease -
PR017_RS19510 (PR017_19510) 370094..370491 + 398 Protein_350 VOC family protein -
PR017_RS19515 (PR017_19515) 370983..371413 - 431 Protein_351 DDE-type integrase/transposase/recombinase -
PR017_RS19520 (PR017_19520) 371409..371723 + 315 WP_240538957.1 SIS domain-containing protein -
PR017_RS19525 (PR017_19525) 371824..372117 - 294 WP_111219181.1 type II toxin-antitoxin system RelE/ParE family toxin Toxin
PR017_RS19530 (PR017_19530) 372114..372356 - 243 WP_111219220.1 type II toxin-antitoxin system ParD family antitoxin Antitoxin
PR017_RS19535 (PR017_19535) 372927..373580 - 654 WP_111219183.1 methionine ABC transporter permease -
PR017_RS19540 (PR017_19540) 373561..374706 - 1146 WP_111219185.1 ATP-binding cassette domain-containing protein -
PR017_RS19545 (PR017_19545) 374694..375497 - 804 WP_111219187.1 MetQ/NlpA family ABC transporter substrate-binding protein -
PR017_RS19550 (PR017_19550) 376028..377041 + 1014 WP_111219189.1 taurine ABC transporter substrate-binding protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Non-Mobilizable plasmid - - 1..834411 834411


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin-antitoxin system, RelE/ParE toxin family

(4-92)

Antitoxin

Antitoxin ParD

(3-70)


Sequences

Toxin        


Download         Length: 98 a.a.        Molecular weight: 11388.01 Da        Isoelectric Point: 5.1911

>T270199 WP_111219181.1 NZ_CP117256:c372117-371824 [Rhizobium tumorigenes]
MSFKLSVEAEEDIIAIAQQGARMFGVDQAKRYHDELFALFDLIAADPRIARERNEIEPPIRIHPFKAHLIVYRVEDDEKI
FVVRIRHGHEDWESISM

Download         Length: 294 bp

Antitoxin


Download         Length: 81 a.a.        Molecular weight: 9042.14 Da        Isoelectric Point: 6.3049

>AT270199 WP_111219220.1 NZ_CP117256:c372356-372114 [Rhizobium tumorigenes]
MATMNVSLPDPMKDWVEAQARTGRYSNASDYVRDLIRRDQTRNDKIAAMQSFVEARLQSGVGIRSKDELFAEAMARTSES

Download         Length: 243 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure

References